PDB entry 3sob

View 3sob on RCSB PDB site
Description: The structure of the first YWTD beta propeller domain of LRP6 in complex with a FAB
Class: protein binding/immune system
Keywords: Beta propeller, PROTEIN BINDING-IMMUNE SYSTEM complex
Deposited on 2011-06-30, released 2011-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-05-14, with a file datestamp of 2014-05-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.176
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Low-density lipoprotein receptor-related protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: LRP6
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: antibody heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3SOB
  • Chain 'L':
    Compound: Antibody Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3SOB
    Domains in SCOPe 2.07: d3sobl1, d3sobl2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3sobL (L:)
    mkkniafllasmfvfsiatnayadiqmtqspsslsasvgdrvtitcrasqdvstavawyq
    qkpgkapklliysasflysgvpsrfsgsgsgtdftltisslqpedfatyycqqsyttppt
    fgqgtkveikrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsg
    nsqesvteqdskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sobL (L:)
    diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps
    rfsgsgsgtdftltisslqpedfatyycqqsyttpptfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge