PDB entry 3so8

View 3so8 on RCSB PDB site
Description: Crystal Structure of ANKRA
Class: protein binding
Keywords: Structural Genomics, Structural Genomics Consortium, SGC, ANK, PROTEIN BINDING
Deposited on 2011-06-30, released 2011-10-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ankyrin repeat family A protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ANKRA2, ANKRA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3so8a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3so8A (A:)
    nslsvhqlaaqgemlylatrieqenvinhtdeegftplmwaaahgqiavvefllqngadp
    qllgkgresalslacskgytdivkmlldcgvdvneydwnggtpllyavhgnhvkcvkmll
    esgadptietdsgynsmdlavalgyrsvqqvieshllkllqn