PDB entry 3so1

View 3so1 on RCSB PDB site
Description: Crystal structure of a double mutant T41S T82S of a betagamma-crystallin domain from Clostridium beijerinckii
Class: metal binding protein
Keywords: calcium-bound betagamma-crystallin, METAL BINDING PROTEIN
Deposited on 2011-06-29, released 2011-11-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-10-09, with a file datestamp of 2013-10-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.217
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Clostrillin
    Species: Clostridium beijerinckii [TaxId:290402]
    Gene: Cbei_2825
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6LX94
      • engineered mutation (41)
      • engineered mutation (82)
    Domains in SCOPe 2.06: d3so1a_
  • Chain 'B':
    Compound: Clostrillin
    Species: Clostridium beijerinckii [TaxId:290402]
    Gene: Cbei_2825
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6LX94
      • engineered mutation (41)
      • engineered mutation (82)
    Domains in SCOPe 2.06: d3so1b_
  • Chain 'C':
    Compound: Clostrillin
    Species: Clostridium beijerinckii [TaxId:290402]
    Gene: Cbei_2825
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6LX94
      • engineered mutation (41)
      • engineered mutation (82)
    Domains in SCOPe 2.06: d3so1c_
  • Chain 'D':
    Compound: Clostrillin
    Species: Clostridium beijerinckii [TaxId:290402]
    Gene: Cbei_2825
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6LX94
      • engineered mutation (41)
      • engineered mutation (82)
    Domains in SCOPe 2.06: d3so1d_
  • Chain 'E':
    Compound: Clostrillin
    Species: Clostridium beijerinckii [TaxId:290402]
    Gene: Cbei_2825
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6LX94
      • engineered mutation (41)
      • engineered mutation (82)
    Domains in SCOPe 2.06: d3so1e_
  • Chain 'F':
    Compound: Clostrillin
    Species: Clostridium beijerinckii [TaxId:290402]
    Gene: Cbei_2825
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6LX94
      • engineered mutation (41)
      • engineered mutation (82)
    Domains in SCOPe 2.06: d3so1f_
  • Chain 'G':
    Compound: Clostrillin
    Species: Clostridium beijerinckii [TaxId:290402]
    Gene: Cbei_2825
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6LX94
      • engineered mutation (41)
      • engineered mutation (82)
    Domains in SCOPe 2.06: d3so1g_
  • Chain 'H':
    Compound: Clostrillin
    Species: Clostridium beijerinckii [TaxId:290402]
    Gene: Cbei_2825
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6LX94 (1-End)
      • engineered mutation (41)
      • engineered mutation (82)
    Domains in SCOPe 2.06: d3so1h_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3so1A (A:)
    mptkavtfyedinyggasvslqpgnytlsqlntakipndwmsslkvpsgwtvdvyendnf
    tgtkwtytsdtpwvgndandkmssvkiysttntggdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3so1A (A:)
    kavtfyedinyggasvslqpgnytlsqlntakipndwmsslkvpsgwtvdvyendnftgt
    kwtytsdtpwvgndandkmssvkiyst
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3so1B (B:)
    mptkavtfyedinyggasvslqpgnytlsqlntakipndwmsslkvpsgwtvdvyendnf
    tgtkwtytsdtpwvgndandkmssvkiysttntggdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3so1B (B:)
    kavtfyedinyggasvslqpgnytlsqlntakipndwmsslkvpsgwtvdvyendnftgt
    kwtytsdtpwvgndandkmssvkiyst
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3so1C (C:)
    mptkavtfyedinyggasvslqpgnytlsqlntakipndwmsslkvpsgwtvdvyendnf
    tgtkwtytsdtpwvgndandkmssvkiysttntggdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3so1C (C:)
    kavtfyedinyggasvslqpgnytlsqlntakipndwmsslkvpsgwtvdvyendnftgt
    kwtytsdtpwvgndandkmssvkiyst
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3so1D (D:)
    mptkavtfyedinyggasvslqpgnytlsqlntakipndwmsslkvpsgwtvdvyendnf
    tgtkwtytsdtpwvgndandkmssvkiysttntggdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3so1D (D:)
    kavtfyedinyggasvslqpgnytlsqlntakipndwmsslkvpsgwtvdvyendnftgt
    kwtytsdtpwvgndandkmssvkiyst
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3so1E (E:)
    mptkavtfyedinyggasvslqpgnytlsqlntakipndwmsslkvpsgwtvdvyendnf
    tgtkwtytsdtpwvgndandkmssvkiysttntggdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3so1E (E:)
    tkavtfyedinyggasvslqpgnytlsqlntakipndwmsslkvpsgwtvdvyendnftg
    tkwtytsdtpwvgndandkmssvkiyst
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3so1F (F:)
    mptkavtfyedinyggasvslqpgnytlsqlntakipndwmsslkvpsgwtvdvyendnf
    tgtkwtytsdtpwvgndandkmssvkiysttntggdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3so1F (F:)
    kavtfyedinyggasvslqpgnytlsqlntakipndwmsslkvpsgwtvdvyendnftgt
    kwtytsdtpwvgndandkmssvkiyst
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3so1G (G:)
    mptkavtfyedinyggasvslqpgnytlsqlntakipndwmsslkvpsgwtvdvyendnf
    tgtkwtytsdtpwvgndandkmssvkiysttntggdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3so1G (G:)
    tkavtfyedinyggasvslqpgnytlsqlntakipndwmsslkvpsgwtvdvyendnftg
    tkwtytsdtpwvgndandkmssvkiyst
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3so1H (H:)
    mptkavtfyedinyggasvslqpgnytlsqlntakipndwmsslkvpsgwtvdvyendnf
    tgtkwtytsdtpwvgndandkmssvkiysttntggdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3so1H (H:)
    ptkavtfyedinyggasvslqpgnytlsqlntakipndwmsslkvpsgwtvdvyendnft
    gtkwtytsdtpwvgndandkmssvkiyst