PDB entry 3snz

View 3snz on RCSB PDB site
Description: Crystal structure of a mutant W39D of a betagamma-crystallin domain from Clostridium beijerinckii
Class: metal binding protein
Keywords: calcium-bound betagamma-crystallin, METAL BINDING PROTEIN
Deposited on 2011-06-29, released 2011-11-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-10-09, with a file datestamp of 2013-10-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Clostrillin
    Species: Clostridium beijerinckii [TaxId:290402]
    Gene: Cbei_2825
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6LX94
      • engineered mutation (39)
    Domains in SCOPe 2.08: d3snza_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3snzA (A:)
mptkavtfyedinyggasvslqpgnytlsqlntakipnddmtslkvpsgwtvdvyendnf
tgtkwtytsdtpwvgndandkmtsvkiysttntggdt

    Sequence, based on observed residues (ATOM records): (download) 
    >3snzA (A:)
kavtfyedinyggasvslqpgnytlsqlntakipnddmtslkvpsgwtvdvyendnftgt
kwtytsdtpwvgndandkmtsvkiyst