PDB entry 3snp

View 3snp on RCSB PDB site
Description: Crystal structure analysis of iron regulatory protein 1 in complex with ferritin H IRE RNA
Class: lyase/RNA
Keywords: RNA binding, iron sulfur cluster binding, phosphorylation, LYASE-RNA complex
Deposited on 2011-06-29, released 2011-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytoplasmic aconitate hydratase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: ACO1, FRP, IREB1, IREBP, IRP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01059 (20-907)
      • see remark 999 (301)
      • engineered mutation (455)
      • see remark 999 (892)
    Domains in SCOPe 2.07: d3snpa1, d3snpa2
  • Chain 'B':
    Compound: Cytoplasmic aconitate hydratase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: ACO1, FRP, IREB1, IREBP, IRP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01059 (20-907)
      • see remark 999 (301)
      • engineered mutation (455)
      • see remark 999 (892)
    Domains in SCOPe 2.07: d3snpb1, d3snpb2
  • Chain 'C':
    Compound: ferritin H IRE RNA
  • Chain 'D':
    Compound: ferritin H IRE RNA
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3snpA (A:)
    mghhhhhhaddddkdgvdklsnpfaylaepldpaqpgkkffnlnkldysrygrlpfsirv
    lleaavrncdkflvkkedienilnwnvtqhmnievpfkparvilqdftgvpsvvdfaamr
    davkklggdpekinpicpvdlvidhsiqvdfnrradslqknqdlefernrerfeflkwgs
    kafrnmriippgsgiihqvnleylarvvfdqdgyyypdslvgtdshttmidglgvlgwgv
    ggieaeavmlgqpismvlpqvigyrlmgkphplvtstdivltitkhlrqvgvvgkfveff
    gpgvaqlsiadratianmcpeygatatffpvdevsikylvqtgrdeskvkqirkylqavg
    mfrdysdpsqdpdftqvveldlktvvpccsgpkrpqdkvavsdmkkdfesclgakqgfkg
    fqvapdhhndhktfiyndseftlshgsvviaaitsstntsnpsvmlgagllakkavdagl
    nvkpyvktslspgsgvvtyylresgvmpylsqlgfdvvgygsmtcignsgplpepvveai
    tqgdlvavgvlsgnrnfegrvhpntranylaspplviayaiagtiridfekeplgtnakg
    qqvflrdiwptreeiqaverqyvipgmftevyqkietvnaswnalaapsdklylwnpkst
    yiksppffenltldlqppksivdayvllnlgdsvttdhispagniarnspaaryltnrgl
    tprefnsygsrrgndaimargtfanirllnrflnkqapqtihlpsgetldvfdaaeryqq
    eghplivlagkeygsgssrdwaakgpfllgikavlaesyerihrsnlvgmgvipleylpg
    enadslgltgrerytiiipenltprmhvqvkldtgktfqavirfdtdveltyfhnggiln
    ymirkmak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3snpA (A:)
    snpfaylaepldpaqpgkkffnlnkldysrygrlpfsirvlleaavrncdkflvkkedie
    nilnwnvtqhmnievpfkparvilqdftgvpsvvdfaamrdavkklggdpekinpicpvd
    lvidhsefernrerfeflkwgskafrnmriippgsgiihqvnleylarvvfdqdgyyypd
    slvgtdshttmidglgvlgwgvggieaeavmlgqpismvlpqvigyrlmgkphplvtstd
    ivltitkhlrqvgvvgkfveffgpgvaqlsiadratianmcpeygatatffpvdevsiky
    lvqtgrdeskvkqirkylqavgmfrdysdpsqdpdftqvveldlktvvpccsgpkrpqdk
    vavsdmkkdfesclgakqgfkgfqvapdhhndhktfiyndseftlshgsvviaaitsstn
    tsnpsvmlgagllakkavdaglnvkpyvktslspgsgvvtyylresgvmpylsqlgfdvv
    plpepvveaitqgdlvavgvlsgnrnfegrvhpntranylaspplviayaiagtiridfe
    keplgtnakgqqvflrdiwptreeiqaverqyvipgmftevyqkietvnaswklylwnpk
    styiksppffenltldlqppksivdayvllnlgdsvttdhispagniarnspaaryltnr
    gltprefnsygsrrgndaimargtfanirllnrflnkqapqtihlpsgetldvfdaaery
    qqeghplivlagkeygsgssrdwaakgpfllgikavlaesyerihrsnlvgmgvipleyl
    pgenadslgltgrerytiiipenltprmhvqvkldtgktfqavirfdtdveltyfhnggi
    lnymirkmak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3snpB (B:)
    mghhhhhhaddddkdgvdklsnpfaylaepldpaqpgkkffnlnkldysrygrlpfsirv
    lleaavrncdkflvkkedienilnwnvtqhmnievpfkparvilqdftgvpsvvdfaamr
    davkklggdpekinpicpvdlvidhsiqvdfnrradslqknqdlefernrerfeflkwgs
    kafrnmriippgsgiihqvnleylarvvfdqdgyyypdslvgtdshttmidglgvlgwgv
    ggieaeavmlgqpismvlpqvigyrlmgkphplvtstdivltitkhlrqvgvvgkfveff
    gpgvaqlsiadratianmcpeygatatffpvdevsikylvqtgrdeskvkqirkylqavg
    mfrdysdpsqdpdftqvveldlktvvpccsgpkrpqdkvavsdmkkdfesclgakqgfkg
    fqvapdhhndhktfiyndseftlshgsvviaaitsstntsnpsvmlgagllakkavdagl
    nvkpyvktslspgsgvvtyylresgvmpylsqlgfdvvgygsmtcignsgplpepvveai
    tqgdlvavgvlsgnrnfegrvhpntranylaspplviayaiagtiridfekeplgtnakg
    qqvflrdiwptreeiqaverqyvipgmftevyqkietvnaswnalaapsdklylwnpkst
    yiksppffenltldlqppksivdayvllnlgdsvttdhispagniarnspaaryltnrgl
    tprefnsygsrrgndaimargtfanirllnrflnkqapqtihlpsgetldvfdaaeryqq
    eghplivlagkeygsgssrdwaakgpfllgikavlaesyerihrsnlvgmgvipleylpg
    enadslgltgrerytiiipenltprmhvqvkldtgktfqavirfdtdveltyfhnggiln
    ymirkmak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3snpB (B:)
    snpfaylaepldpaqpgkkffnlnkldysrygrlpfsirvlleaavrncdkflvkkedie
    nilnwnvtqhmnievpfkparvilqdftgvpsvvdfaamrdavkklggdpekinpicpvd
    lvidhsefernrerfeflkwgskafrnmriippgsgiihqvnleylarvvfdqdgyyypd
    slvgtdshttmidglgvlgwgvggieaeavmlgqpismvlpqvigyrlmgkphplvtstd
    ivltitkhlrqvgvvgkfveffgpgvaqlsiadratianmcpeygatatffpvdevsiky
    lvqtgrdeskvkqirkylqavgmfrdysdpsqdpdftqvveldlktvvpccsgpkrpqdk
    vavsdmkkdfesclgakqgfkgfqvapdhhndhktfiyndseftlshgsvviaaitsstn
    tsnpsvmlgagllakkavdaglnvkpyvktslspgsgvvtyylresgvmpylsqlgfdvv
    plpepvveaitqgdlvavgvlsgnrnfegrvhpntranylaspplviayaiagtiridfe
    keplgtnakgqqvflrdiwptreeiqaverqyvipgmftevyqkietvnaswklylwnpk
    styiksppffenltldlqppksivdayvllnlgdsvttdhispagniarnspaaryltnr
    gltprefnsygsrrgndaimargtfanirllnrflnkqapqtihlpsgetldvfdaaery
    qqeghplivlagkeygsgssrdwaakgpfllgikavlaesyerihrsnlvgmgvipleyl
    pgenadslgltgrerytiiipenltprmhvqvkldtgktfqavirfdtdveltyfhnggi
    lnymirkmak
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.