PDB entry 3snf

View 3snf on RCSB PDB site
Description: Onconase, atomic resolution crystal structure
Class: hydrolase
Keywords: ribonuclease, alpha/beta, Hydrolase
Deposited on 2011-06-29, released 2011-10-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein P-30
    Species: Rana pipiens [TaxId:8404]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3snfa_
  • Heterogens: SO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3snfA (A:)
    edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt
    sefylsdcnvtsrpckyklkkstnkfcvtcenqapvhfvgvgsc