PDB entry 3snc

View 3snc on RCSB PDB site
Description: Crystal structure of SARS coronavirus main protease complexed with Ac-NSTSQ-H (soaking)
Class: hydrolase/hydrolase inhibitor
Keywords: 3C-like proteinase, protease, Ac-NSTSQ-H, ACTIVE SITE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-06-29, released 2011-09-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-09, with a file datestamp of 2011-11-04.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: 0.219
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3C-like proteinase
    Species: SARS coronavirus [TaxId:227859]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3snca_
  • Chain 'H':
    Compound: Peptide aldehyde inhibitor Ac-NSTSQ-H
    Database cross-references and differences (RAF-indexed):
    • PDB 3SNC (Start-4)
  • Heterogens: DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3sncA (A:)
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
sgvtfq

  • Chain 'H':
    No sequence available.