PDB entry 3sn9

View 3sn9 on RCSB PDB site
Description: Fic protein from NEISSERIA MENINGITIDIS mutant S182A/E186A in complex with AMPPNP
Class: transferase
Keywords: AMPylation, adenylylation, TRANSFERASE
Deposited on 2011-06-29, released 2012-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 3.03 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell filamentation protein Fic-related protein
    Species: NEISSERIA MENINGITIDIS [TaxId:491]
    Gene: NMB0255
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sn9a_
  • Chain 'B':
    Compound: Cell filamentation protein Fic-related protein
    Species: NEISSERIA MENINGITIDIS [TaxId:491]
    Gene: NMB0255
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sn9b_
  • Chain 'C':
    Compound: Cell filamentation protein Fic-related protein
    Species: NEISSERIA MENINGITIDIS [TaxId:491]
    Gene: NMB0255
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sn9c_
  • Chain 'D':
    Compound: Cell filamentation protein Fic-related protein
    Species: NEISSERIA MENINGITIDIS [TaxId:491]
    Gene: NMB0255
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sn9d_
  • Chain 'E':
    Compound: Cell filamentation protein Fic-related protein
    Species: NEISSERIA MENINGITIDIS [TaxId:491]
    Gene: NMB0255
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sn9e_
  • Chain 'F':
    Compound: Cell filamentation protein Fic-related protein
    Species: NEISSERIA MENINGITIDIS [TaxId:491]
    Gene: NMB0255
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sn9f_
  • Chain 'G':
    Compound: Cell filamentation protein Fic-related protein
    Species: NEISSERIA MENINGITIDIS [TaxId:491]
    Gene: NMB0255
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sn9g_
  • Chain 'H':
    Compound: Cell filamentation protein Fic-related protein
    Species: NEISSERIA MENINGITIDIS [TaxId:491]
    Gene: NMB0255
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sn9h_
  • Chain 'I':
    Compound: Cell filamentation protein Fic-related protein
    Species: NEISSERIA MENINGITIDIS [TaxId:491]
    Gene: NMB0255
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sn9i_
  • Chain 'J':
    Compound: Cell filamentation protein Fic-related protein
    Species: NEISSERIA MENINGITIDIS [TaxId:491]
    Gene: NMB0255
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sn9j_
  • Chain 'K':
    Compound: Cell filamentation protein Fic-related protein
    Species: NEISSERIA MENINGITIDIS [TaxId:491]
    Gene: NMB0255
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sn9k_
  • Chain 'L':
    Compound: Cell filamentation protein Fic-related protein
    Species: NEISSERIA MENINGITIDIS [TaxId:491]
    Gene: NMB0255
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sn9l_
  • Chain 'M':
    Compound: Cell filamentation protein Fic-related protein
    Species: NEISSERIA MENINGITIDIS [TaxId:491]
    Gene: NMB0255
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sn9m_
  • Chain 'N':
    Compound: Cell filamentation protein Fic-related protein
    Species: NEISSERIA MENINGITIDIS [TaxId:491]
    Gene: NMB0255
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sn9n_
  • Chain 'O':
    Compound: Cell filamentation protein Fic-related protein
    Species: NEISSERIA MENINGITIDIS [TaxId:491]
    Gene: NMB0255
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sn9o_
  • Chain 'P':
    Compound: Cell filamentation protein Fic-related protein
    Species: NEISSERIA MENINGITIDIS [TaxId:491]
    Gene: NMB0255
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sn9p_
  • Heterogens: ANP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sn9A (A:)
    mhhhhhhmksideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqired
    niskggfrfanamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldl
    vlkknlkkvvnwqnvsktlylqamerspvndlelrfllkdnltddvdnreiifkgieqay
    yyagyekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sn9A (A:)
    sideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggfrf
    anamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldlvlkknlkkv
    vnwqnvsktlylqamerspvndlelrfllkdnltddvd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3sn9B (B:)
    mhhhhhhmksideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqired
    niskggfrfanamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldl
    vlkknlkkvvnwqnvsktlylqamerspvndlelrfllkdnltddvdnreiifkgieqay
    yyagyekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sn9B (B:)
    sideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggfrf
    anamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldlvlkknlkkv
    vnwqnvsktlylqamerspvndlelrfllkdnltddvd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3sn9C (C:)
    mhhhhhhmksideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqired
    niskggfrfanamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldl
    vlkknlkkvvnwqnvsktlylqamerspvndlelrfllkdnltddvdnreiifkgieqay
    yyagyekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sn9C (C:)
    sideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggfrf
    anamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldlvlkknlkkv
    vnwqnvsktlylqamerspvndlelrfllkdnltddvd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3sn9D (D:)
    mhhhhhhmksideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqired
    niskggfrfanamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldl
    vlkknlkkvvnwqnvsktlylqamerspvndlelrfllkdnltddvdnreiifkgieqay
    yyagyekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sn9D (D:)
    sideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggfrf
    anamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldlvlkknlkkv
    vnwqnvsktlylqamerspvndlelrfllkdnltddvd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3sn9E (E:)
    mhhhhhhmksideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqired
    niskggfrfanamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldl
    vlkknlkkvvnwqnvsktlylqamerspvndlelrfllkdnltddvdnreiifkgieqay
    yyagyekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sn9E (E:)
    sideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggfrf
    anamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldlvlkknlkkv
    vnwqnvsktlylqamerspvndlelrfllkdnltddvd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3sn9F (F:)
    mhhhhhhmksideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqired
    niskggfrfanamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldl
    vlkknlkkvvnwqnvsktlylqamerspvndlelrfllkdnltddvdnreiifkgieqay
    yyagyekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sn9F (F:)
    sideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggfrf
    anamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldlvlkknlkkv
    vnwqnvsktlylqamerspvndlelrfllkdnltddvd
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3sn9G (G:)
    mhhhhhhmksideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqired
    niskggfrfanamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldl
    vlkknlkkvvnwqnvsktlylqamerspvndlelrfllkdnltddvdnreiifkgieqay
    yyagyekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sn9G (G:)
    sideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggfrf
    anamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldlvlkknlkkv
    vnwqnvsktlylqamerspvndlelrfllkdnltddvd
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3sn9H (H:)
    mhhhhhhmksideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqired
    niskggfrfanamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldl
    vlkknlkkvvnwqnvsktlylqamerspvndlelrfllkdnltddvdnreiifkgieqay
    yyagyekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sn9H (H:)
    sideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggfrf
    anamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldlvlkknlkkv
    vnwqnvsktlylqamerspvndlelrfllkdnltddvd
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3sn9I (I:)
    mhhhhhhmksideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqired
    niskggfrfanamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldl
    vlkknlkkvvnwqnvsktlylqamerspvndlelrfllkdnltddvdnreiifkgieqay
    yyagyekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sn9I (I:)
    sideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggfrf
    anamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldlvlkknlkkv
    vnwqnvsktlylqamerspvndlelrfllkdnltddvd
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3sn9J (J:)
    mhhhhhhmksideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqired
    niskggfrfanamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldl
    vlkknlkkvvnwqnvsktlylqamerspvndlelrfllkdnltddvdnreiifkgieqay
    yyagyekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sn9J (J:)
    sideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggfrf
    anamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldlvlkknlkkv
    vnwqnvsktlylqamerspvndlelrfllkdnltddvd
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3sn9K (K:)
    mhhhhhhmksideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqired
    niskggfrfanamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldl
    vlkknlkkvvnwqnvsktlylqamerspvndlelrfllkdnltddvdnreiifkgieqay
    yyagyekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sn9K (K:)
    sideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggfrf
    anamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldlvlkknlkkv
    vnwqnvsktlylqamerspvndlelrfllkdnltddvd
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3sn9L (L:)
    mhhhhhhmksideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqired
    niskggfrfanamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldl
    vlkknlkkvvnwqnvsktlylqamerspvndlelrfllkdnltddvdnreiifkgieqay
    yyagyekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sn9L (L:)
    sideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggfrf
    anamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldlvlkknlkkv
    vnwqnvsktlylqamerspvndlelrfllkdnltddvd
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3sn9M (M:)
    mhhhhhhmksideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqired
    niskggfrfanamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldl
    vlkknlkkvvnwqnvsktlylqamerspvndlelrfllkdnltddvdnreiifkgieqay
    yyagyekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sn9M (M:)
    sideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggfrf
    anamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldlvlkknlkkv
    vnwqnvsktlylqamerspvndlelrfllkdnltddvd
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3sn9N (N:)
    mhhhhhhmksideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqired
    niskggfrfanamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldl
    vlkknlkkvvnwqnvsktlylqamerspvndlelrfllkdnltddvdnreiifkgieqay
    yyagyekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sn9N (N:)
    sideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggfrf
    anamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldlvlkknlkkv
    vnwqnvsktlylqamerspvndlelrfllkdnltddvd
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3sn9O (O:)
    mhhhhhhmksideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqired
    niskggfrfanamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldl
    vlkknlkkvvnwqnvsktlylqamerspvndlelrfllkdnltddvdnreiifkgieqay
    yyagyekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sn9O (O:)
    sideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggfrf
    anamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldlvlkknlkkv
    vnwqnvsktlylqamerspvndlelrfllkdnltddvd
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3sn9P (P:)
    mhhhhhhmksideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqired
    niskggfrfanamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldl
    vlkknlkkvvnwqnvsktlylqamerspvndlelrfllkdnltddvdnreiifkgieqay
    yyagyekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sn9P (P:)
    sideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggfrf
    anamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldlvlkknlkkv
    vnwqnvsktlylqamerspvndlelrfllkdnltddvd