PDB entry 3sms

View 3sms on RCSB PDB site
Description: Human Pantothenate kinase 3 in complex with a pantothenate analog
Class: transferase
Keywords: structural genomics consortium, sgc, TRANSFERASE
Deposited on 2011-06-28, released 2011-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.193
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pantothenate kinase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PANK3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3smsa1, d3smsa2
  • Heterogens: ADP, RNH, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3smsA (A:)
    mgsshhhhhhssglvprgssfpwfgmdiggtlvklsyfepiditaeeeqeeveslksirk
    yltsnvaygstgirdvhlelkdltlfgrrgnlhfirfptqdlptfiqmgrdknfstlqtv
    lcatgggaykfekdfrtignlhlhkldeldclvkgllyidsvsfngqaecyyfanasepe
    rcqkmpfnlddpypllvvnigsgvsilavhskdnykrvtgtslgggtflglcslltgces
    feealemaskgdstqadklvrdiyggdyerfglpgwavassfgnmiykekresvskedla
    ratlvtitnnigsvarmcavnekinrvvfvgnflrvntlsmkllayaldywskgqlkalf
    lehegyfgavgallglpnfsdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3smsA (A:)
    fpwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyltsnvaygstgirdvhlel
    kdltlfgrrgnlhfirfptqdlptfiqmgrdtvlcatgggaykfekdfrtignlhlhkld
    eldclvkgllyidsvsfngqaecyyfanasepercqkmpfnlddpypllvvnigsgvsil
    avhskdnykrvtgtslgggtflglcslltgcesfeealemaskgdstqadklvrdiyggd
    yerfglpgwavassfgnmiykekresvskedlaratlvtitnnigsvarmcavnekinrv
    vfvgnflrvntlsmkllayaldywskgqlkalflehegyfgavgallglpn