PDB entry 3smb

View 3smb on RCSB PDB site
Description: Phenethylisothiocyanate Covalently Bound to Macrophage Migration Inhibitory Factor (MIF)
Class: isomerase/isomerase inhibitor
Keywords: cytokine, receptor binding, secreted, ISOMERASE-ISOMERASE INHIBITOR complex
Deposited on 2011-06-27, released 2012-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: GLIF, MIF, MMIF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3smba_
  • Chain 'B':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: GLIF, MIF, MMIF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3smbb_
  • Chain 'C':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: GLIF, MIF, MMIF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3smbc_
  • Heterogens: LE2, CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3smbA (A:)
    pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
    lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3smbB (B:)
    pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
    lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3smbC (C:)
    pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
    lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa