PDB entry 3sm9

View 3sm9 on RCSB PDB site
Description: Crystal Structure of Metabotropic glutamate receptor 3 precursor in presence of LY341495 antagonist
Class: signaling protein
Keywords: Structural Genomics, Structural Genomics Consortium, SGC, Cell membrane, G-protein coupled receptor, Glycoprotein, Membrane, Olfaction, Phosphoprotein, Receptor, Sensory transduction, Transducer, Transmembrane, Transmembrane helix, SIGNALING PROTEIN
Deposited on 2011-06-27, released 2011-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metabotropic glutamate receptor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: GPRC1C, GRM3, MGLUR3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14832
      • conflict (214)
    Domains in SCOPe 2.07: d3sm9a_
  • Heterogens: SO4, Z99, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sm9A (A:)
    hnflrreikiegdlvlgglfpinekgtgteecgrinedrgiqrleamlfaideinkddyl
    lpgvklgvhildtcsrdtyaleqslefvrasltkvdeaeymcpdgsyaiqeniplliagv
    iggsyssvsiqvanllrlfqipqisyastsaklsdksrydyfartvppdfyqakamaeil
    rffnwtyvstvasegdygetgieafeqearlrnisiataekvgrsnirksydsvirellq
    kpnarvvvlfmrsddsreliaaasranasftwvasdgwgaqesiikgsehvaygaitlel
    asqpvrqfdryfqslnpynnhrnpwfrdfweqkfqcslqnkrnhrrvcdkhlaidssnye
    qeskimfvvnavyamahalhkmqrtlcpnttklcdamkildgkklykdyllkinftapfn
    pnkdadsivkfdtfgdgmgrynvfnfqnvggkysylkvghwaetlsldvnsihwsrnsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sm9A (A:)
    rreikiegdlvlgglfpinekgtteecgrinedrgiqrleamlfaideinkddyllpgvk
    lgvhildtcsrdtyaleqslefvraslliagviggsyssvsiqvanllrlfqipqisyas
    tsaklsdksrydyfartvppdfyqakamaeilrffnwtyvstvasegdygetgieafeqe
    arlrnisiataekvgrirksydsvirellqkpnarvvvlfmrsddsreliaaasranasf
    twvasdgwgaqesiikgsehvaygaitlelasqpvrqfdryfqslnpynnhrnpwfrdfw
    eqkfqcslqnhrrvcdkhlaidssnyeqeskimfvvnavyamahalhkmqrtlcpnttkl
    cdamkildgkklykdyllkinftapfndsivkfdtfgdgmgrynvfnfqnvggkysylkv
    ghwaetlsldvnsihws