PDB entry 3sm5

View 3sm5 on RCSB PDB site
Description: Influenza hemagglutinin in complex with a neutralizing antibody
Class: immune system
Keywords: Influenza Hemagglutinin, IMMUNE SYSTEM
Deposited on 2011-06-27, released 2011-08-10
Made obsolete by 5ugy on 2017-01-25

The last revision prior to the SCOPe 2.06 freeze date was dated 2011-09-14, with a file datestamp of 2011-09-09.
Experiment type: XRAY
Resolution: 3.19 Å
R-factor: 0.212
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:464623]
    Gene: HA, Hemagglutinin (HA)
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7UPX0 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.06: d3sm5a1, d3sm5a2
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:497434]
    Gene: HA, Hemagglutinin (HA)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3sm5b_
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:464623]
    Gene: HA, Hemagglutinin (HA)
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7UPX0 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.06: d3sm5c1, d3sm5c2
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:497434]
    Gene: HA, Hemagglutinin (HA)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3sm5d_
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:464623]
    Gene: HA, Hemagglutinin (HA)
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7UPX0 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.06: d3sm5e1, d3sm5e2
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:497434]
    Gene: HA, Hemagglutinin (HA)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3sm5f_
  • Chain 'H':
    Compound: CH65, heavy chain, Fab fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3SM5 (0-226)
  • Chain 'I':
    Compound: CH65, heavy chain, Fab fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3SM5 (0-226)
  • Chain 'J':
    Compound: CH65, heavy chain, Fab fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3SM5 (0-226)
  • Chain 'L':
    Compound: CH65, light chain, Fab fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3SM5 (Start-210)
    Domains in SCOPe 2.06: d3sm5l1, d3sm5l2
  • Chain 'M':
    Compound: CH65, light chain, Fab fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3SM5 (Start-210)
    Domains in SCOPe 2.06: d3sm5m1, d3sm5m2
  • Chain 'N':
    Compound: CH65, light chain, Fab fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3SM5 (Start-210)
    Domains in SCOPe 2.06: d3sm5n1, d3sm5n2
  • Heterogens: MAN, NAG, SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sm5A (A:)
    edticigyhannstdtvdtvleknvtvthsvnlledshngklcllkgiaplqlgncsvag
    wilgnpecellisreswsyivekpnpengtcypghfadyeelreqlssvssferfeifpk
    esswpnhtttgvsascshngessfyknllwltgknglypnlsksyannkekevlvlwgvh
    hppnigdqralyhtenayvsvvsshysrkftpeiakrpkvrdregrinyywtllepgdti
    ifeangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfqnvhpvti
    gecpkyvrsaklrmvtglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sm5A (A:)
    edticigyhannstdtvdtvleknvtvthsvnlledshngklcllkgiaplqlgncsvag
    wilgnpecellisreswsyivekpnpengtcypghfadyeelreqlssvssferfeifpk
    esswpnhtttgvsascshngessfyknllwltgknglypnlsksyannkekevlvlwgvh
    hppnigdqralyhtenayvsvvsshysrkftpeiakrpkvrdregrinyywtllepgdti
    ifeangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfqnvhpvti
    gecpkyvrsaklrmvtglrnips
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3sm5B (B:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    tqftavgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcndecmesvkngtydypkyseesklnrekidgvrslv
    pr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sm5B (B:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    tqftavgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcndecmesvkngtydypkyseesklnreki
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3sm5C (C:)
    edticigyhannstdtvdtvleknvtvthsvnlledshngklcllkgiaplqlgncsvag
    wilgnpecellisreswsyivekpnpengtcypghfadyeelreqlssvssferfeifpk
    esswpnhtttgvsascshngessfyknllwltgknglypnlsksyannkekevlvlwgvh
    hppnigdqralyhtenayvsvvsshysrkftpeiakrpkvrdregrinyywtllepgdti
    ifeangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfqnvhpvti
    gecpkyvrsaklrmvtglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sm5C (C:)
    edticigyhannstdtvdtvleknvtvthsvnlledshngklcllkgiaplqlgncsvag
    wilgnpecellisreswsyivekpnpengtcypghfadyeelreqlssvssferfeifpk
    esswpnhtttgvsascshngessfyknllwltgknglypnlsksyannkekevlvlwgvh
    hppnigdqralyhtenayvsvvsshysrkftpeiakrpkvrdregrinyywtllepgdti
    ifeangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfqnvhpvti
    gecpkyvrsaklrmvtglrnips
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3sm5D (D:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    tqftavgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcndecmesvkngtydypkyseesklnrekidgvrslv
    pr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sm5D (D:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    tqftavgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcndecmesvkngtydypkyseesklnreki
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3sm5E (E:)
    edticigyhannstdtvdtvleknvtvthsvnlledshngklcllkgiaplqlgncsvag
    wilgnpecellisreswsyivekpnpengtcypghfadyeelreqlssvssferfeifpk
    esswpnhtttgvsascshngessfyknllwltgknglypnlsksyannkekevlvlwgvh
    hppnigdqralyhtenayvsvvsshysrkftpeiakrpkvrdregrinyywtllepgdti
    ifeangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfqnvhpvti
    gecpkyvrsaklrmvtglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sm5E (E:)
    edticigyhannstdtvdtvleknvtvthsvnlledshngklcllkgiaplqlgncsvag
    wilgnpecellisreswsyivekpnpengtcypghfadyeelreqlssvssferfeifpk
    esswpnhtttgvsascshngessfyknllwltgknglypnlsksyannkekevlvlwgvh
    hppnigdqralyhtenayvsvvsshysrkftpeiakrpkvrdregrinyywtllepgdti
    ifeangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfqnvhpvti
    gecpkyvrsaklrmvtglrnips
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3sm5F (F:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    tqftavgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcndecmesvkngtydypkyseesklnrekidgvrslv
    pr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sm5F (F:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    tqftavgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcndecmesvkngtydypkyseesklnreki
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3sm5L (L:)
    qsvltqppsvsvapgqtaritcggndigrksvhwnqqkpgqapvlvvcydsdrpsgiper
    fsgsnsgntatltisrveagdeadyycqvwdsssdhvifgggtkltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvapt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sm5L (L:)
    svltqppsvsvapgqtaritcggndigrksvhwnqqkpgqapvlvvcydsdrpsgiperf
    sgsnsgntatltisrveagdeadyycqvwdsssdhvifgggtkltvlgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3sm5M (M:)
    qsvltqppsvsvapgqtaritcggndigrksvhwnqqkpgqapvlvvcydsdrpsgiper
    fsgsnsgntatltisrveagdeadyycqvwdsssdhvifgggtkltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvapt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sm5M (M:)
    svltqppsvsvapgqtaritcggndigrksvhwnqqkpgqapvlvvcydsdrpsgiperf
    sgsnsgntatltisrveagdeadyycqvwdsssdhvifgggtkltvlgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3sm5N (N:)
    qsvltqppsvsvapgqtaritcggndigrksvhwnqqkpgqapvlvvcydsdrpsgiper
    fsgsnsgntatltisrveagdeadyycqvwdsssdhvifgggtkltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvapt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sm5N (N:)
    svltqppsvsvapgqtaritcggndigrksvhwnqqkpgqapvlvvcydsdrpsgiperf
    sgsnsgntatltisrveagdeadyycqvwdsssdhvifgggtkltvlgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvapt