PDB entry 3sls

View 3sls on RCSB PDB site
Description: Crystal Structure of human MEK-1 kinase in complex with UCB1353770 and AMPPNP
Class: transferase/transferase inhibitor
Keywords: Serine-threonine kinase, Signalling, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-06-25, released 2012-02-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.21
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dual specificity mitogen-activated protein kinase kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Human MEK-1 kinase, MAP2K1, MEK1, PRKMK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02750 (3-303)
      • expression tag (0-2)
      • insertion (222)
    Domains in SCOPe 2.04: d3slsa_
  • Chain 'B':
    Compound: Dual specificity mitogen-activated protein kinase kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Human MEK-1 kinase, MAP2K1, MEK1, PRKMK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02750 (3-303)
      • expression tag (0-2)
      • insertion (222)
      • insertion (227)
    Domains in SCOPe 2.04: d3slsb_
  • Heterogens: ANP, MG, 77D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3slsA (A:)
    mtlqqrkrleafltqkqkvgelkdddfekiselgagnggvvfkvshkpsglvmarklihl
    eikpairnqiirelqvlhecnspyivgfygafysdgeisicmehmdggsldqvlkkagri
    peqilgkvsiavikgltylrekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlidsman
    sfvgtrsymsperlqgthysvqsdiwsmglslvemavgrypigsgsgsmaifelldyivn
    epppklpsgvfslefqdfvnkcliknpaeradlkqlmvhafikrsdaeevdfagwlcsti
    glnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3slsA (A:)
    mtlqqrkrleafltqkqkvgelkdddfekiselgagnggvvfkvshkpsglvmarklihl
    eikpairnqiirelqvlhecnspyivgfygafysdgeisicmehmdggsldqvlkkagri
    peqilgkvsiavikgltylrekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlifvgtr
    symsperlqgthysvqsdiwsmglslvemavgrypigaifelldyivnepppklpsgvfs
    lefqdfvnkcliknpaeradlkqlmvhafikrsdaeevdfagwlcstiglnq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3slsB (B:)
    mtlqqrkrleafltqkqkvgelkdddfekiselgagnggvvfkvshkpsglvmarklihl
    eikpairnqiirelqvlhecnspyivgfygafysdgeisicmehmdggsldqvlkkagri
    peqilgkvsiavikgltylrekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlidsman
    sfvgtrsymsperlqgthysvqsdiwsmglslvemavgrypigsgsgsmaifelldyivn
    epppklpsgvfslefqdfvnkcliknpaeradlkqlmvhafikrsdaeevdfagwlcsti
    glnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3slsB (B:)
    mtlqqrkrleafltqkqkvgelkdddfekiselgagnggvvfkvshkpsglvmarklihl
    eikpairnqiirelqvlhecnspyivgfygafysdgeisicmehmdggsldqvlkkagri
    peqilgkvsiavikgltylrekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlidfvgt
    rsymsperlqgthysvqsdiwsmglslvemavgrypigsmaifelldyivnepppklpsg
    vfslefqdfvnkcliknpaeradlkqlmvhafikrsdaeevdfagwlcstiglnq