PDB entry 3slg

View 3slg on RCSB PDB site
Description: Crystal structure of PbgP3 protein from Burkholderia pseudomallei
Class: transferase
Keywords: Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, melioidosis, glanders, NAD-dependent epimerase/dehydratase family protein, TRANSFERASE
Deposited on 2011-06-24, released 2011-07-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-06, with a file datestamp of 2011-07-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.179
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PbgP3 protein
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710b_2404
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3slga_
  • Chain 'B':
    Compound: PbgP3 protein
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710b_2404
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3slgb_
  • Chain 'C':
    Compound: PbgP3 protein
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710b_2404
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3slgc_
  • Chain 'D':
    Compound: PbgP3 protein
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710b_2404
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3slgd_
  • Chain 'E':
    Compound: PbgP3 protein
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710b_2404
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3slge_
  • Chain 'F':
    Compound: PbgP3 protein
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710b_2404
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3slgf_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3slgA (A:)
    mahhhhhhmgtleaqtqgpgsmkakkvlilgvngfighhlskrilettdwevfgmdmqtd
    rlgdlvkhermhffegditinkewveyhvkkcdvilplvaiatpatyvkqplrvfeldfe
    anlpivrsavkygkhlvfpstsevygmcadeqfdpdasaltygpinkprwiyacskqlmd
    rviwgygmeglnftlfrpfnwigpgldsiytpkegssrvvtqflghivrgenislvdggs
    qkraftyvddgisalmkiiensngvatgkiynignpnnnfsvrelankmlelaaefpeya
    dsakrvklvettsgayygngyqdvqnrvpkientmqelgwapqftfddalrqifeayrgh
    vadaralveqhg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3slgA (A:)
    kakkvlilgvngfighhlskrilettdwevfgmdmqtdrlgdlvkhermhffegditink
    ewveyhvkkcdvilplvaiatpatyvkqplrvfeldfeanlpivrsavkygkhlvfpsts
    evygmcadeqfdpdasaltygpinkprwiyacskqlmdrviwgygmeglnftlfrpfnwi
    gpgldsiytpkegssrvvtqflghivrgenislvdggsqkraftyvddgisalmkiiens
    ngvatgkiynignpnnnfsvrelankmlelaaefpeyadsakrvklvetqnrvpkientm
    qelgwapqftfddalrqifeayrghvadaralve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3slgB (B:)
    mahhhhhhmgtleaqtqgpgsmkakkvlilgvngfighhlskrilettdwevfgmdmqtd
    rlgdlvkhermhffegditinkewveyhvkkcdvilplvaiatpatyvkqplrvfeldfe
    anlpivrsavkygkhlvfpstsevygmcadeqfdpdasaltygpinkprwiyacskqlmd
    rviwgygmeglnftlfrpfnwigpgldsiytpkegssrvvtqflghivrgenislvdggs
    qkraftyvddgisalmkiiensngvatgkiynignpnnnfsvrelankmlelaaefpeya
    dsakrvklvettsgayygngyqdvqnrvpkientmqelgwapqftfddalrqifeayrgh
    vadaralveqhg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3slgB (B:)
    kakkvlilgvngfighhlskrilettdwevfgmdmqtdrlgdlvkhermhffegditink
    ewveyhvkkcdvilplvaiatpatyvkqplrvfeldfeanlpivrsavkygkhlvfpsts
    evygmcadeqfdpdasaltygpinkprwiyacskqlmdrviwgygmeglnftlfrpfnwi
    gpgldsiytpkegssrvvtqflghivrgenislvdggsqkraftyvddgisalmkiiens
    ngvatgkiynignpnnnfsvrelankmlelaaefpeyadsakrvklvetqnrvpkientm
    qelgwapqftfddalrqifeayrghvadaralve
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3slgC (C:)
    mahhhhhhmgtleaqtqgpgsmkakkvlilgvngfighhlskrilettdwevfgmdmqtd
    rlgdlvkhermhffegditinkewveyhvkkcdvilplvaiatpatyvkqplrvfeldfe
    anlpivrsavkygkhlvfpstsevygmcadeqfdpdasaltygpinkprwiyacskqlmd
    rviwgygmeglnftlfrpfnwigpgldsiytpkegssrvvtqflghivrgenislvdggs
    qkraftyvddgisalmkiiensngvatgkiynignpnnnfsvrelankmlelaaefpeya
    dsakrvklvettsgayygngyqdvqnrvpkientmqelgwapqftfddalrqifeayrgh
    vadaralveqhg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3slgC (C:)
    kakkvlilgvngfighhlskrilettdwevfgmdmqtdrlgdlvkhermhffegditink
    ewveyhvkkcdvilplvaiatpatyvkqplrvfeldfeanlpivrsavkygkhlvfpsts
    evygmcadeqfdpdasaltygpinkprwiyacskqlmdrviwgygmeglnftlfrpfnwi
    gpgldsiytpkegssrvvtqflghivrgenislvdggsqkraftyvddgisalmkiiens
    ngvatgkiynignpnnnfsvrelankmlelaaefpeyadsakrvklvettqnrvpkient
    mqelgwapqftfddalrqifeayrghvadaralve
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3slgD (D:)
    mahhhhhhmgtleaqtqgpgsmkakkvlilgvngfighhlskrilettdwevfgmdmqtd
    rlgdlvkhermhffegditinkewveyhvkkcdvilplvaiatpatyvkqplrvfeldfe
    anlpivrsavkygkhlvfpstsevygmcadeqfdpdasaltygpinkprwiyacskqlmd
    rviwgygmeglnftlfrpfnwigpgldsiytpkegssrvvtqflghivrgenislvdggs
    qkraftyvddgisalmkiiensngvatgkiynignpnnnfsvrelankmlelaaefpeya
    dsakrvklvettsgayygngyqdvqnrvpkientmqelgwapqftfddalrqifeayrgh
    vadaralveqhg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3slgD (D:)
    kakkvlilgvngfighhlskrilettdwevfgmdmqtdrlgdlvkhermhffegditink
    ewveyhvkkcdvilplvaiatpatyvkqplrvfeldfeanlpivrsavkygkhlvfpsts
    evygmcadeqfdpdasaltygpinkprwiyacskqlmdrviwgygmeglnftlfrpfnwi
    gpgldsiytpkegssrvvtqflghivrgenislvdggsqkraftyvddgisalmkiiens
    ngvatgkiynignpnnnfsvrelankmlelaaefpeyadsakrvklvettnrvpkientm
    qelgwapqftfddalrqifeayrghvadaralve
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3slgE (E:)
    mahhhhhhmgtleaqtqgpgsmkakkvlilgvngfighhlskrilettdwevfgmdmqtd
    rlgdlvkhermhffegditinkewveyhvkkcdvilplvaiatpatyvkqplrvfeldfe
    anlpivrsavkygkhlvfpstsevygmcadeqfdpdasaltygpinkprwiyacskqlmd
    rviwgygmeglnftlfrpfnwigpgldsiytpkegssrvvtqflghivrgenislvdggs
    qkraftyvddgisalmkiiensngvatgkiynignpnnnfsvrelankmlelaaefpeya
    dsakrvklvettsgayygngyqdvqnrvpkientmqelgwapqftfddalrqifeayrgh
    vadaralveqhg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3slgE (E:)
    kakkvlilgvngfighhlskrilettdwevfgmdmqtdrlgdlvkhermhffegditink
    ewveyhvkkcdvilplvaiatpatyvkqplrvfeldfeanlpivrsavkygkhlvfpsts
    evygmcadeqfdpdasaltygpinkprwiyacskqlmdrviwgygmeglnftlfrpfnwi
    gpgldsiytpkegssrvvtqflghivrgenislvdggsqkraftyvddgisalmkiiens
    ngvatgkiynignpnnnfsvrelankmlelaaefpeyadsakrvklvetqnrvpkientm
    qelgwapqftfddalrqifeayrghvadaralve
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3slgF (F:)
    mahhhhhhmgtleaqtqgpgsmkakkvlilgvngfighhlskrilettdwevfgmdmqtd
    rlgdlvkhermhffegditinkewveyhvkkcdvilplvaiatpatyvkqplrvfeldfe
    anlpivrsavkygkhlvfpstsevygmcadeqfdpdasaltygpinkprwiyacskqlmd
    rviwgygmeglnftlfrpfnwigpgldsiytpkegssrvvtqflghivrgenislvdggs
    qkraftyvddgisalmkiiensngvatgkiynignpnnnfsvrelankmlelaaefpeya
    dsakrvklvettsgayygngyqdvqnrvpkientmqelgwapqftfddalrqifeayrgh
    vadaralveqhg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3slgF (F:)
    kakkvlilgvngfighhlskrilettdwevfgmdmqtdrlgdlvkhermhffegditink
    ewveyhvkkcdvilplvaiatpatyvkqplrvfeldfeanlpivrsavkygkhlvfpsts
    evygmcadeqfdpdasaltygpinkprwiyacskqlmdrviwgygmeglnftlfrpfnwi
    gpgldsiytpkegssrvvtqfgsqkraftyvddgisalmkiiensngvatgkiynignpn
    nnfsvrelankmlelaaefpnrvpkientmqelgwapqftfddalrqifeayrghvadar
    a