PDB entry 3sle

View 3sle on RCSB PDB site
Description: Crystal Structure of the P107C-MauG/pre-Methylamine Dehydrogenase Complex
Class: oxidoreductase/electron transport
Keywords: Oxidoreductase, OXIDOREDUCTASE-ELECTRON TRANSPORT complex
Deposited on 2011-06-24, released 2012-05-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: 0.178
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Methylamine utilization protein MauG
  Species: Paracoccus denitrificans [TaxId:318586]
  Gene: mauG, Pden_4736
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q51658
    • engineered mutation (106)
• Chain 'B':
  Compound: Methylamine utilization protein MauG
  Species: Paracoccus denitrificans [TaxId:318586]
  Gene: mauG, Pden_4736
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q51658
    • engineered mutation (106)
• Chain 'C':
  Compound: Methylamine dehydrogenase light chain
  Species: Paracoccus denitrificans [TaxId:318586]
  Gene: mauA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22619 (Start-130)
    • expression tag (131-134)
  Domains in SCOPe 2.03: d3slec_
• Chain 'D':
  Compound: Methylamine dehydrogenase heavy chain
  Species: Paracoccus denitrificans [TaxId:318586]
  Gene: mauB, pden_4730
  Database cross-references and differences (RAF-indexed):
  • Uniprot A1BB97 (Start-384)
• Chain 'E':
  Compound: Methylamine dehydrogenase light chain
  Species: Paracoccus denitrificans [TaxId:318586]
  Gene: mauA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22619 (Start-130)
  Domains in SCOPe 2.03: d3slee_
• Chain 'F':
  Compound: Methylamine dehydrogenase heavy chain
  Species: Paracoccus denitrificans [TaxId:318586]
  Gene: mauB, pden_4730
  Database cross-references and differences (RAF-indexed):
  • Uniprot A1BB97 (Start-384)
• Heterogens: CA, HEC, ACT, EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >3sleC (C:)
  adapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvas
  cynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyh
  ctispivgkashhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3sleC (C:)
  tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
  gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
  vgkashhhh
  

  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  Sequence, based on SEQRES records: (download)
  

  >3sleE (E:)
  adapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvas
  cynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyh
  ctispivgkashhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3sleE (E:)
  tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
  gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
  vgkas
  

  
  
• Chain 'F':
  No sequence available.