PDB entry 3sl6

View 3sl6 on RCSB PDB site
Description: Crystal structure of the catalytic domain of PDE4D2 with compound 12c
Class: Hydrolase/Hydrolase Inhibitor
Keywords: catalytic domain, cAMP hydrolysis, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2011-06-24, released 2011-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: 0.201
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sl6a_
  • Chain 'B':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sl6b_
  • Chain 'C':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sl6c_
  • Chain 'D':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sl6d_
  • Heterogens: ZN, EDO, JN8, DMS, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sl6A (A:)
    iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
    vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
    ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
    slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
    lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
    plwetwadlvhpdaqdildtlednrewyqstipqspspapddpeegrqgqtekfqfeltl
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sl6A (A:)
    vkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtli
    tylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvd
    hpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkm
    vidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnpt
    kplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwet
    wadlvhpdaqdildtlednrewyqsti
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3sl6B (B:)
    iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
    vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
    ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
    slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
    lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
    plwetwadlvhpdaqdildtlednrewyqstipqspspapddpeegrqgqtekfqfeltl
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sl6B (B:)
    qedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylm
    tledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgv
    snqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidi
    vlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkplq
    lyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadl
    vhpdaqdildtlednrewyqstipq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3sl6C (C:)
    iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
    vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
    ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
    slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
    lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
    plwetwadlvhpdaqdildtlednrewyqstipqspspapddpeegrqgqtekfqfeltl
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sl6C (C:)
    teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
    lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
    gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
    divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
    lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
    dlvhpdaqdildtlednrewyqsti
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3sl6D (D:)
    iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
    vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
    ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
    slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
    lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
    plwetwadlvhpdaqdildtlednrewyqstipqspspapddpeegrqgqtekfqfeltl
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sl6D (D:)
    qedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylm
    tledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgv
    snqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidi
    vlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkplq
    lyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadl
    vhpdaqdildtlednrewyqstip