PDB entry 3sl3

View 3sl3 on RCSB PDB site
Description: Crystal structure of the apo form of the catalytic domain of PDE4D2
Class: hydrolase
Keywords: catalytic mechanism, cAMP hydrolysis, Hydrolase
Deposited on 2011-06-24, released 2011-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: DPDE3, PDE4D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sl3a_
  • Chain 'B':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: DPDE3, PDE4D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sl3b_
  • Chain 'C':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: DPDE3, PDE4D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sl3c_
  • Chain 'D':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: DPDE3, PDE4D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sl3d_
  • Heterogens: EDO, PEG, ZN, PO4, DMS, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sl3A (A:)
    iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
    vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
    ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
    slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
    lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
    plwetwadlvhpdaqdildtlednrewyqstipqspspapddpeegrqgqtekfqfeltl
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sl3A (A:)
    gvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtl
    itylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdv
    dhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrk
    mvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnp
    tkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwe
    twadlvhpdaqdildtlednrewyqst
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3sl3B (B:)
    iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
    vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
    ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
    slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
    lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
    plwetwadlvhpdaqdildtlednrewyqstipqspspapddpeegrqgqtekfqfeltl
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sl3B (B:)
    lakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylmtled
    hyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgvsnqf
    lintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidivlat
    dmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkplqlyrq
    wtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadlvhpd
    aqdildtlednrewyqstip
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3sl3C (C:)
    iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
    vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
    ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
    slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
    lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
    plwetwadlvhpdaqdildtlednrewyqstipqspspapddpeegrqgqtekfqfeltl
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sl3C (C:)
    eqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlityl
    mtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpg
    vsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvid
    ivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkpl
    qlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwad
    lvhpdaqdildtlednrewyqsti
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3sl3D (D:)
    iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
    vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
    ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
    slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
    lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
    plwetwadlvhpdaqdildtlednrewyqstipqspspapddpeegrqgqtekfqfeltl
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sl3D (D:)
    qedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylm
    tledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgv
    snqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidi
    vlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkplq
    lyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadl
    vhpdaqdildtlednrewyqstip