PDB entry 3skn

View 3skn on RCSB PDB site
Description: Crystal structure of the RL42 TCR unliganded
Class: immune system
Keywords: T cell receptor, IMMUNE SYSTEM
Deposited on 2011-06-22, released 2012-02-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-08-01, with a file datestamp of 2012-07-27.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.199
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RL42 T cell receptor, alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3SKN
    Domains in SCOPe 2.06: d3skna1, d3skna2
  • Chain 'B':
    Compound: RL42 T cell receptor, beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3SKN (Start-243)
    Domains in SCOPe 2.06: d3sknb1, d3sknb2
  • Chain 'C':
    Compound: RL42 T cell receptor, alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3SKN
    Domains in SCOPe 2.06: d3sknc1, d3sknc2
  • Chain 'D':
    Compound: RL42 T cell receptor, beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3SKN (Start-243)
    Domains in SCOPe 2.06: d3sknd1, d3sknd2
  • Chain 'E':
    Compound: RL42 T cell receptor, alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3SKN
    Domains in SCOPe 2.06: d3skne1, d3skne2
  • Chain 'F':
    Compound: RL42 T cell receptor, beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3SKN (Start-243)
    Domains in SCOPe 2.06: d3sknf1, d3sknf2
  • Chain 'G':
    Compound: RL42 T cell receptor, alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3SKN
    Domains in SCOPe 2.06: d3skng1, d3skng2
  • Chain 'H':
    Compound: RL42 T cell receptor, beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3SKN (Start-243)
    Domains in SCOPe 2.06: d3sknh1, d3sknh2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sknA (A:)
    hmrkeveqdpgpfnvpegatvafnctysnsasqsffwyrqdsrkepkllmsvyssgnedg
    rftaqlnrasqyisllirdsklsdsatylcvvragklifgqgtelsvkpniqnpdpavyq
    lrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdf
    acanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sknA (A:)
    keveqdpgpfnvpegatvafnctysnsasqsffwyrqdsrkepkllmsvyssgnedgrft
    aqlnrasqyisllirdsklsdsatylcvvragklifgqgtelsvkpniqnpdpavyqlrd
    skssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdfaca
    nafnnsiipedtffpsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3sknB (B:)
    hmnagvtqtpkfrvlktgqsmtllcaqdmnheymywyrqdpgmglrlihysvgegttakg
    evpdgynvsrlkkqnfllglesaapsqtsvyfcasgqgnfdiqyfgagtrlsvledlknv
    fppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeq
    palndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeaw
    grad
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sknB (B:)
    agvtqtpkfrvlktgqsmtllcaqdmnheymywyrqdpgmglrlihysvgegttakgevp
    dgynvsrlkkqnfllglesaapsqtsvyfcasgqgnfdiqyfgagtrlsvledlknvfpp
    evavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpal
    ndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra
    d
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3sknC (C:)
    hmrkeveqdpgpfnvpegatvafnctysnsasqsffwyrqdsrkepkllmsvyssgnedg
    rftaqlnrasqyisllirdsklsdsatylcvvragklifgqgtelsvkpniqnpdpavyq
    lrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdf
    acanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sknC (C:)
    keveqdpgpfnvpegatvafnctysnsasqsffwyrqdsrkepkllmsvyssgnedgrft
    aqlnrasqyisllirdsklsdsatylcvvragklifgqgtelsvkpniqnpdpavyqlrd
    skssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdfaca
    nafnnsiipedtffpsp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3sknD (D:)
    hmnagvtqtpkfrvlktgqsmtllcaqdmnheymywyrqdpgmglrlihysvgegttakg
    evpdgynvsrlkkqnfllglesaapsqtsvyfcasgqgnfdiqyfgagtrlsvledlknv
    fppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeq
    palndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeaw
    grad
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sknD (D:)
    agvtqtpkfrvlktgqsmtllcaqdmnheymywyrqdpgmglrlihysvgegttakgevp
    dgynvsrlkkqnfllglesaapsqtsvyfcasgqgnfdiqyfgagtrlsvledlknvfpp
    evavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpal
    ndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra
    d
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3sknE (E:)
    hmrkeveqdpgpfnvpegatvafnctysnsasqsffwyrqdsrkepkllmsvyssgnedg
    rftaqlnrasqyisllirdsklsdsatylcvvragklifgqgtelsvkpniqnpdpavyq
    lrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdf
    acanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sknE (E:)
    keveqdpgpfnvpegatvafnctysnsasqsffwyrqdsrkepkllmsvyssgnedgrft
    aqlnrasqyisllirdsklsdsatylcvvragklifgqgtelsvkpniqnpdpavyqlrd
    skssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdfaca
    nafnnsiipedtffpsp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3sknF (F:)
    hmnagvtqtpkfrvlktgqsmtllcaqdmnheymywyrqdpgmglrlihysvgegttakg
    evpdgynvsrlkkqnfllglesaapsqtsvyfcasgqgnfdiqyfgagtrlsvledlknv
    fppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeq
    palndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeaw
    grad
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sknF (F:)
    agvtqtpkfrvlktgqsmtllcaqdmnheymywyrqdpgmglrlihysvgegttakgevp
    dgynvsrlkkqnfllglesaapsqtsvyfcasgqgnfdiqyfgagtrlsvledlknvfpp
    evavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpal
    ndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra
    d
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3sknG (G:)
    hmrkeveqdpgpfnvpegatvafnctysnsasqsffwyrqdsrkepkllmsvyssgnedg
    rftaqlnrasqyisllirdsklsdsatylcvvragklifgqgtelsvkpniqnpdpavyq
    lrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdf
    acanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sknG (G:)
    keveqdpgpfnvpegatvafnctysnsasqsffwyrqdsrkepkllmsvyssgnedgrft
    aqlnrasqyisllirdsklsdsatylcvvragklifgqgtelsvkpniqnpdpavyqlrd
    skssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdfaca
    nafnnsiipedtffpsp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3sknH (H:)
    hmnagvtqtpkfrvlktgqsmtllcaqdmnheymywyrqdpgmglrlihysvgegttakg
    evpdgynvsrlkkqnfllglesaapsqtsvyfcasgqgnfdiqyfgagtrlsvledlknv
    fppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeq
    palndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeaw
    grad
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sknH (H:)
    agvtqtpkfrvlktgqsmtllcaqdmnheymywyrqdpgmglrlihysvgegttakgevp
    dgynvsrlkkqnfllglesaapsqtsvyfcasgqgnfdiqyfgagtrlsvledlknvfpp
    evavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpal
    ndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra
    d