PDB entry 3skj

View 3skj on RCSB PDB site
Description: Structural And Functional Characterization of an Agonistic Anti-Human EphA2 Monoclonal Antibody
Class: immune system
Keywords: Fab, receptor, Ig fold, ephrin receptor, antibody, antigen, extra-cellular, IMMUNE SYSTEM
Deposited on 2011-06-22, released 2011-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-31, with a file datestamp of 2017-05-26.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Ephrin type-A receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHA2, ECK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3skje_
  • Chain 'F':
    Compound: Ephrin type-A receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHA2, ECK
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: antibody, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3SKJ (0-230)
  • Chain 'I':
    Compound: antibody, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3SKJ (0-230)
  • Chain 'L':
    Compound: antibody, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3SKJ (0-213)
    Domains in SCOPe 2.07: d3skjl1, d3skjl2
  • Chain 'M':
    Compound: antibody, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3SKJ (0-213)
    Domains in SCOPe 2.07: d3skjm1, d3skjm2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3skjE (E:)
    apehhhhhhdydipttenlyfqgamdaaqgkevvlldfaaaggelgwlthpygkgwdlmq
    nimndmpiymysvcnvmsgdqdnwlrtnwvyrgeaerifielkftvrdcnsfpggassck
    etfnlyyaesdldygtnfqkrlftkidtiapdeitvssdfearhvklnveersvgpltrk
    gfylafqdigacvallsvrvyykkcp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3skjE (E:)
    qgkevvlldfaaaggelgwlthpygkgwdlmqnimndmpiymysvcnvmsgdqdnwlrtn
    wvyrgeaerifielkftvrdcnsfpggasscketfnlyyaesdldygtnfqkrlftkidt
    iapdeitvssdfearhvklnveersvgpltrkgfylafqdigacvallsvrvyykk
    

  • Chain 'F':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3skjL (L:)
    diqmtqspsslsasvgdrvtitcrasqsistwlawyqqkpgkapklliykasnlhtgvps
    rfsgsgsgtefsltisglqpddfatyycqqynsysrtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3skjM (M:)
    diqmtqspsslsasvgdrvtitcrasqsistwlawyqqkpgkapklliykasnlhtgvps
    rfsgsgsgtefsltisglqpddfatyycqqynsysrtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec