PDB entry 3sju

View 3sju on RCSB PDB site
Description: Hedamycin Polyketide Ketoreductase bound to NADPH
Class: oxidoreductase
Keywords: short-chain dehydrogenase, reductase, oxidoreductase, Rossmann Fold, Type II Polyketide Ketoreductase
Deposited on 2011-06-21, released 2011-09-07
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-09-07, with a file datestamp of 2011-09-02.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.185
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Keto reductase
    Species: Streptomyces griseoruber [TaxId:1943]
    Gene: hedA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Keto reductase
    Species: Streptomyces griseoruber [TaxId:1943]
    Gene: hedA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3sjub_
  • Heterogens: NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3sjuB (B:)
    mgsshhhhhhssglvprgshmsrpqtafvtgvssgiglavartlaargiavygcardakn
    vsaavdglraaghdvdgsscdvtstdevhaavaaaverfgpigilvnsagrngggetadl
    ddalwadvldtnltgvfrvtrevlraggmreagwgrivniastggkqgvmyaapytaskh
    gvvgftksvgfelaktgitvnavcpgyvetpmaervregyarhwgvteqevherfnakip
    lgrystpeevaglvgylvtdaaasitaqalnvcgglgny
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sjuB (B:)
    qtafvtgvssgiglavartlaargiavygcardaknvsaavdglraaghdvdgsscdvts
    tdevhaavaaaverfgpigilvnsagrngggetadlddalwadvldtnltgvfrvtrevl
    raggmreagwgrivniastggkqgvmyaapytaskhgvvgftksvgfelaktgitvnavc
    pgyvetpmaervregyarhwgvteqevherfnakiplgrystpeevaglvgylvtdaaas
    itaqalnvcgglgny