PDB entry 3sj6

View 3sj6 on RCSB PDB site
Description: Crystal Structure of the complex of type I ribosome inactivating protein from momordica balsamina with 5-(hydroxymethyl)oxalane-2,3,4-triol at 1.6 A resolution
Class: hydrolase
Keywords: RIP, RNA N-glycosidase, Plant protein, ribose, inactivation, HYDROLASE
Deposited on 2011-06-21, released 2011-08-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.171
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosome inactivating protein
    Species: Momordica balsamina [TaxId:3672]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3sj6a_
  • Heterogens: NAG, RIP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3sj6A (A:)
    dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
    tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
    prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
    pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
    lntkni