PDB entry 3sj0

View 3sj0 on RCSB PDB site
Description: PpcA mutant M58S
Class: electron transport
Keywords: three heme cytochrome c7, electron transport
Deposited on 2011-06-20, released 2012-07-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-03, with a file datestamp of 2021-02-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'X':
  Compound: cytochrome c7
  Species: Geobacter sulfurreducens [TaxId:35554]
  Gene: ppcA, GSU0612
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8GGK7 (0-70)
    • engineered mutation (57)
  Domains in SCOPe 2.08: d3sj0x_
• Heterogens: HEC, DXC, SO4, HOH

PDB Chain Sequences:

• Chain 'X':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3sj0X (X:)
  addivlkakngdvkfphkahqkavpdckkchekgpgkiegfgkemahgkgckgcheeskk
  gptkcgechkk