PDB entry 3sil

View 3sil on RCSB PDB site
Description: sialidase from salmonella typhimurium
Class: glycosidase
Keywords: glycosidase, hydrolase
Deposited on 1998-07-07, released 1998-11-11
The last revision prior to the SCOP 1.75 freeze date was dated 1999-01-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.116
AEROSPACI score: 1.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sialidase
    Species: SALMONELLA TYPHIMURIUM
    Gene: NANH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29768 (0-378)
      • engineered (325)
    Domains in SCOP 1.75: d3sila_
  • Heterogens: K, PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3silA (A:)
    eksvvfkaegehftdqkgntivgsgsggttkyfripamcttskgtivvfadarhntasdq
    sfidtaaarstdggktwnkkiaiyndrvnsklsrvmdptcivaniqgretilvmvgkwnn
    ndktwgayrdkapdtdwdlvlykstddgvtfskvetnihdivtkngtisamlggvgsglq
    lndgklvfpvqmvrtknittvlntsfiystdgitwslpsgycegfgsenniiefnaslvn
    nirnsglrrsfetkdfgktwtefppmdkkvdnrnhgvqgstitipsgnklvaahssaqnk
    nndytrsdislyahnlysgevkliddfypkvgnasgagysclsyrknvdketlyvvyean
    gsiefqdlsrhlpviksyn