PDB entry 3sil

View 3sil on RCSB PDB site
Description: sialidase from salmonella typhimurium
Deposited on 1998-07-07, released 1998-11-11
The last revision prior to the SCOP 1.57 freeze date was dated 1999-01-13, with a file datestamp of 1999-01-20.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.1162
AEROSPACI score: 0.99 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d3sil__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3sil_ (-)
    eksvvfkaegehftdqkgntivgsgsggttkyfripamcttskgtivvfadarhntasdq
    sfidtaaarstdggktwnkkiaiyndrvnsklsrvmdptcivaniqgretilvmvgkwnn
    ndktwgayrdkapdtdwdlvlykstddgvtfskvetnihdivtkngtisamlggvgsglq
    lndgklvfpvqmvrtknittvlntsfiystdgitwslpsgycegfgsenniiefnaslvn
    nirnsglrrsfetkdfgktwtefppmdkkvdnrnhgvqgstitipsgnklvaahssaqnk
    nndytrsdislyahnlysgevkliddfypkvgnasgagysclsyrknvdketlyvvyean
    gsiefqdlsrhlpviksyn