PDB entry 3si2

View 3si2 on RCSB PDB site
Description: Structure of glycosylated murine glutaminyl cyclase in presence of the inhibitor PQ50 (PDBD150)
Class: transferase/transferase inhibitor
Keywords: alpha/beta hydrolase, Alzheimer's disease, pyroglutamate, pGlu, pE, pGlu-amyloid, glycosylation, glycoprotein, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-06-17, released 2011-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutaminyl-peptide cyclotransferase
    Species: Mus musculus [TaxId:10090]
    Gene: QPCT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3si2a_
  • Heterogens: ZN, NAG, PBD, SO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3si2A (A:)
    awtqeknhhqpahlnssslqqvaegtsisemwqndlrpllierypgspgsysarqhimqr
    iqrlqaewvvevdtflsrtpygyrsfsniistlnpeakrhlvlachydskyfprwdsrvf
    vgatdsavpcammlelaraldkklhslkdvsgskpdlslqliffdgeeafhhwspqdsly
    gsrhlaqkmassphppgsrgtnqldgmdllvlldligaanptfpnffpkttrwfnrlqai
    ekelyelgllkdhslerkyfqnfgygniiqddhipflrkgvpvlhliaspfpevwhtmdd
    neenlhastidnlnkiiqvfvleylhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3si2A (A:)
    awtqeknhhqpahlnssslqqvaegtsisemwqndlrpllierypgspgsysarqhimqr
    iqrlqaewvvevdtflsrtpygyrsfsniistlnpeakrhlvlachydskyfprwdsrvf
    vgatdsavpcammlelaraldkklhslkdpdlslqliffdgeeafhhwspqdslygsrhl
    aqkmassphppgsrgtnqldgmdllvlldligaanptfpnffpkttrwfnrlqaiekely
    elgllkdhslerkyfqnfgygniiqddhipflrkgvpvlhliaspfpevwhtmddneenl
    hastidnlnkiiqvfvleylhl