PDB entry 3shy

View 3shy on RCSB PDB site
Description: Crystal structure of the PDE5A1 catalytic domain in complex with novel inhibitors
Class: hydrolase/hydrolase inhibitor
Keywords: PDE5A INHIBITOR, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-06-17, released 2011-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cGMP-specific 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE5, PDE5A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3shya_
  • Heterogens: 5FO, ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3shyA (A:)
    mgsshhhhhhssglvprgshmeetrelqslaaavvpsaqtlkitdfsfsdfelsdletal
    ctirmftdlnlvqnfqmkhevlcrwilsvkknyrknvayhnwrhafntaqcmfaalkagk
    iqnkltdleilalliaalshdldhrgvnnsyiqrsehplaqlychsimehhhfdqclmil
    nspgnqilsglsieeykttlkiikqailatdlalyikrrgeffelirknqfnledphqke
    lflamlmtacdlsaitkpwpiqqriaelvateffdqgdrerkelnieptdlmnrekknki
    psmqvgfidaiclqlyealthvsedcfplldgcrknrqkwqalaeqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3shyA (A:)
    etrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhevl
    crwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshdl
    dhrgvnnsyiqrsehsimehhhfdqclmilnspgnqilsglsieeykttlkiikqailat
    dlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpiqqriaelva
    teffdqkknkipsmqvgfidaiclqlyealthvsedcfplldgcrknrqkwqalaeqq