PDB entry 3shl

View 3shl on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS V74KL25A at cryogenic temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, hyperstable variant, pdTp, cavity, pressure, HYDROLASE
Deposited on 2011-06-16, released 2011-06-29
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-06-29, with a file datestamp of 2011-06-24.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.189
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (24)
      • engineered mutation (43-44)
      • engineered mutation (67)
      • engineered mutation (110)
      • engineered mutation (117)
      • engineered mutation (121)
    Domains in SCOPe 2.01: d3shla_
  • Heterogens: THP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3shlA (A:)
atstkklhkepatlikaidgdtvkamykgqpmtfrlllvdtpefnekygpeasaftkkmv
enakkiekefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
kaeaqakkeklniwsednadsgq

    Sequence, based on observed residues (ATOM records): (download) 
    >3shlA (A:)
lhkepatlikaidgdtvkamykgqpmtfrlllvdtpefnekygpeasaftkkmvenakki
ekefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkaeaqa
kkeklniws