PDB entry 3shi

View 3shi on RCSB PDB site
Description: Crystal structure of human MMP1 catalytic domain at 2.2 A resolution
Class: hydrolase
Keywords: matrix metalloproteinase, paramagnetic restraints, paramagnetic tag, lanthanides, protein refinement, residual dipolar couplings, HYDROLASE
Deposited on 2011-06-16, released 2011-09-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interstitial collagenase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP1, CLG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3shia_
  • Chain 'G':
    Compound: interstitial collagenase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP1, CLG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3shig_
  • Chain 'M':
    Compound: interstitial collagenase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP1, CLG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3shim_
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3shiA (A:)
    nprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfvr
    gdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghslg
    lshstdigalmypsytfsgdvqlaqddidgiqaiyg
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3shiG (G:)
    nprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfvr
    gdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghslg
    lshstdigalmypsytfsgdvqlaqddidgiqaiyg
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3shiM (M:)
    nprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfvr
    gdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghslg
    lshstdigalmypsytfsgdvqlaqddidgiqaiyg