PDB entry 3shh

View 3shh on RCSB PDB site
Description: Crystal structure of glucarate dehydratase from Agrobacterium tumefaciens complexed with magnesium and L-tartrate
Class: lyase
Keywords: Enolase fold, D-glucarate dehydratase, L-tartrate, LYASE
Deposited on 2011-06-16, released 2012-06-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-24, with a file datestamp of 2012-10-19.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.149
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucarate dehydratase
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: AGR_L_2751, Atu3453
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CSI0 (20-401)
      • expression tag (18-19)
    Domains in SCOPe 2.06: d3shha1, d3shha2, d3shha3
  • Chain 'B':
    Compound: glucarate dehydratase
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: AGR_L_2751, Atu3453
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CSI0 (20-401)
      • expression tag (18-19)
    Domains in SCOPe 2.06: d3shhb1, d3shhb2, d3shhb3
  • Heterogens: TLA, PEG, GOL, MG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3shhA (A:)
    mgsshhhhhhssglvprgshmiitdvevrvfrtttrrhsdsaghahpgpahqveqamltv
    rtedgqeghsftapeivrphviekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrt
    lavvdcalwdlagrslgqpvykliggyrdkvlaygsimcgdelegglatpedygrfaetl
    vkrgykgiklhtwmppvswapdvkmdlkacaavreavgpdirlmidafhwysrtdalalg
    rgleklgfdwieepmdeqslssykwlsdnldipvvgpesaagkhwhraewikagacdilr
    tgvndvggitpalktmhlaeafgmecevhgntamnlhvvaatkncrwyergllhpfleyd
    dghdylkslsdpmdrdgfvhvpdrpglgedidftfidnnrvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3shhA (A:)
    shmiitdvevrvfrtttrrhsdsaghahpgpahqveqamltvrtedgqeghsftapeivr
    phviekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrtlavvdcalwdlagrslgq
    pvykliggyrdkvlaygsimcgdelegglatpedygrfaetlvkrgykgiklhtwmppvs
    wapdvkmdlkacaavreavgpdirlmidafhwysrtdalalgrgleklgfdwieepmdeq
    slssykwlsdnldipvvgpesaagkhwhraewikagacdilrtgvndvggitpalktmhl
    aeafgmecevhgntamnlhvvaatkncrwyergllhpfleyddghdylkslsdpmdrdgf
    vhvpdrpglgedidftfidnnrvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3shhB (B:)
    mgsshhhhhhssglvprgshmiitdvevrvfrtttrrhsdsaghahpgpahqveqamltv
    rtedgqeghsftapeivrphviekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrt
    lavvdcalwdlagrslgqpvykliggyrdkvlaygsimcgdelegglatpedygrfaetl
    vkrgykgiklhtwmppvswapdvkmdlkacaavreavgpdirlmidafhwysrtdalalg
    rgleklgfdwieepmdeqslssykwlsdnldipvvgpesaagkhwhraewikagacdilr
    tgvndvggitpalktmhlaeafgmecevhgntamnlhvvaatkncrwyergllhpfleyd
    dghdylkslsdpmdrdgfvhvpdrpglgedidftfidnnrvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3shhB (B:)
    shmiitdvevrvfrtttrrhsdsaghahpgpahqveqamltvrtedgqeghsftapeivr
    phviekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrtlavvdcalwdlagrslgq
    pvykliggyrdkvlaygsimcgdelegglatpedygrfaetlvkrgykgiklhtwmppvs
    wapdvkmdlkacaavreavgpdirlmidafhwysrtdalalgrgleklgfdwieepmdeq
    slssykwlsdnldipvvgpesaagkhwhraewikagacdilrtgvndvggitpalktmhl
    aeafgmecevhgntamnlhvvaatkncrwyergllhpfleyddghdylkslsdpmdrdgf
    vhvpdrpglgedidftfidnnrvr