PDB entry 3she

View 3she on RCSB PDB site
Description: Novel ATP-competitive MK2 inhibitors with potent biochemical and cell-based activity throughout the series
Class: transferase/transferase inhibitor
Keywords: Kinase domain with bound inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-06-16, released 2011-12-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-01-11, with a file datestamp of 2012-01-06.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.248
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MAP kinase-activated protein kinase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3shea_
  • Heterogens: I85, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sheA (A:)
    epkkyavtddyqlskqvlglgvngkvlecfhrrtgqkcalkllydspkarqevdhhwqas
    ggphivcildvyenmhhgkrclliimecmeggelfsriqergdqaftereaaeimrdigt
    aiqflhshniahrdvkpenllytskekdavlkltdfgfakettqnalqtpcytpyyvape
    vlgpekydkscdmwslgvimyillcgfppfysntgqaispgmkrrirlgqygfpnpewse
    vsedakqlirlllktdpterltitqfmnhpwinqsmvvpqtplhtarvlqedkdhwdevk
    eemtsalatmrvdydqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sheA (A:)
    epkkyavtddyqlskqvlglgvngkvlecfhrrtgqkcalkllydspkarqevdhhwqas
    ggphivcildvyenmhhgkrclliimecmeggelfsriqeaftereaaeimrdigtaiqf
    lhshniahrdvkpenllytskekdavlkltdfgfaketekydkscdmwslgvimyillcg
    fppfygfpnpewsevsedakqlirlllktdpterltitqfmnhpwinqsmvvpqtplhta
    rvlqedkdhwdevkeemtsalatmrvdydq