PDB entry 3sh5

View 3sh5 on RCSB PDB site
Description: Calcium-bound Laminin G like domain 3 from human perlecan
Class: metal binding protein
Keywords: Actin disassambly activity, integrin alpha 2 beta 1, METAL BINDING PROTEIN
Deposited on 2011-06-16, released 2011-12-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.225
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LG3 peptide
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3sh5a_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sh5A (A:)
    dapgqygayfhddgflafpghvfsrslpevpetielevrtstasglllwqgvevgeagqg
    kdfislglqdghlvfryqlgsgearlvsedpindgewhrvtalregrrgsiqvdgeelvs
    grspgpnvavnakgsvyiggapdvatltggrfssgitgcvknlvlhsarpgapppqpldl
    qhraqagantrpcps
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sh5A (A:)
    gayfhddgflafpghvfsrslpevpetielevrtstasglllwqgvegkdfislglqdgh
    lvfryqlgsgearlvsedpindgewhrvtalregrrgsiqvdgeelvsgrspgpnvavna
    kgsvyiggapdvatltggrfssgitgcvknlvlhsarpgapppqpldlqhraqagantrp
    cps