PDB entry 3sh4

View 3sh4 on RCSB PDB site
Description: Laminin G like domain 3 from human perlecan
Class: metal binding protein
Keywords: Actin disassambly, integrin alpha12 beta1, METAL BINDING PROTEIN
Deposited on 2011-06-15, released 2011-12-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.179
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LG3 peptide
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3sh4a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3sh4A (A:)
    dapgqygayfhddgflafpghvfsrslpevpetielevrtstasglllwqgvevgeagqg
    kdfislglqdghlvfryqlgsgearlvsedpindgewhrvtalregrrgsiqvdgeelvs
    grspgpnvavnakgsvyiggapdvatltggrfssgitgcvknlvlhsarpgapppqpldl
    qhraqagantrpcps