PDB entry 3sh0

View 3sh0 on RCSB PDB site
Description: Crystal Structure of E. coli undecaprenyl pyrophosphate synthase in complex with BPH-1065
Class: TRANSFERASE/TRANSFERASE Inhibitor
Keywords: Alpha/beta, TRANSFERASE-TRANSFERASE Inhibitor complex
Deposited on 2011-06-15, released 2012-12-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.17
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: undecaprenyl pyrophosphate synthase
    Species: Escherichia coli [TaxId:83333]
    Gene: uppS, ispU, rth, yaeS, b0174, JW0169
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3sh0a_
  • Chain 'B':
    Compound: undecaprenyl pyrophosphate synthase
    Species: Escherichia coli [TaxId:83333]
    Gene: uppS, ispU, rth, yaeS, b0174, JW0169
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3sh0b_
  • Heterogens: SAX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sh0A (A:)
    mmlsatqplseklpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaann
    giealtlyafssenwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrl
    qerirksealtagntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqh
    vcmhelapvdlvirtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre
    rrfggtepgdeta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sh0A (A:)
    gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafsfvwal
    dsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaanyggrwdivq
    gvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehrisnfllwqiayae
    lyftdvlwpdfdeqdfegalnafanr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3sh0B (B:)
    mmlsatqplseklpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaann
    giealtlyafssenwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrl
    qerirksealtagntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqh
    vcmhelapvdlvirtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre
    rrfggtepgdeta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sh0B (B:)
    lpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafss
    aqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntglt
    lniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtgge
    hrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre