PDB entry 3sgv

View 3sgv on RCSB PDB site
Description: Crystal Structure of E. coli undecaprenyl pyrophosphate synthase in complex with BPH-1290
Class: transferase
Keywords: Alpha/beta, TRANSFERASE
Deposited on 2011-06-15, released 2012-12-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: 0.176
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: undecaprenyl pyrophosphate synthase
    Species: Escherichia coli [TaxId:83333]
    Gene: b0174, ispU, JW0169, rth, uppS, yaeS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3sgva_
  • Chain 'B':
    Compound: undecaprenyl pyrophosphate synthase
    Species: Escherichia coli [TaxId:83333]
    Gene: b0174, ispU, JW0169, rth, uppS, yaeS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3sgvb_
  • Heterogens: 2BJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sgvA (A:)
    mmlsatqplseklpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaann
    giealtlyafssenwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrl
    qerirksealtagntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqh
    vcmhelapvdlvirtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre
    rrfggtepgdeta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sgvA (A:)
    gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafssenwn
    rpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntg
    ltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtg
    gehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3sgvB (B:)
    mmlsatqplseklpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaann
    giealtlyafssenwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrl
    qerirksealtagntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqh
    vcmhelapvdlvirtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre
    rrfggtepgdeta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sgvB (B:)
    lpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafvs
    almelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaa
    nyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehrisn
    fllwqiayaelyftdvlwpdfdeqdfegalnafanre