PDB entry 3sgq

View 3sgq on RCSB PDB site
Description: gln 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 10.7
Deposited on 1999-03-25, released 2003-08-26
The last revision prior to the SCOP 1.71 freeze date was dated 2003-08-26, with a file datestamp of 2003-08-26.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Domains in SCOP 1.71: d3sgqe_
  • Chain 'I':
    Domains in SCOP 1.71: d3sgqi_

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3sgqE (E:)
    isggdaiysstgrcslgfnvrsgstyyfltaghctdgattwwansarttvlgttsgssfp
    nndygivrytnttipkdgtvggqditsaanatvgmavtrrgsttgthsgsvtalnatvny
    gggdvvygmirtnvcaepgdsggplysgtraigltsggsgncssggttffqpvtealsay
    gvsvy
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3sgqI (I:)
    vdcseypkpactqeyrplcgsdnktygnkcnfcnavvesngtltlshfgkc