PDB entry 3sgj

View 3sgj on RCSB PDB site
Description: Unique carbohydrate-carbohydrate interactions are required for high affinity binding between FcgIII and antibodies lacking core fucose
Class: immune system
Keywords: receptor complex, Fc receptor, antibody, IMMUNE SYSTEM
Deposited on 2011-06-15, released 2011-08-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human Fc fragment
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3sgja1, d3sgja2
  • Chain 'B':
    Compound: human Fc fragment
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3sgjb1, d3sgjb2
  • Chain 'C':
    Compound: human Fcg3a receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: CD16A, FCG3, FCGR3, FCGR3A, IGFR3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08637
      • engineered mutation (37)
      • engineered mutation (73)
      • see remark 999 (157)
      • engineered mutation (168)
    Domains in SCOPe 2.06: d3sgjc1, d3sgjc2
  • Heterogens: MLI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sgjA (A:)
    thtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgv
    evhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgq
    prepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdg
    sfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sgjA (A:)
    cppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevh
    naktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqpre
    pqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsff
    lyskltvdksrwqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3sgjB (B:)
    thtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgv
    evhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgq
    prepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdg
    sfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sgjB (B:)
    ppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhn
    aktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprep
    qvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsffl
    yskltvdksrwqqgnvfscsvmhealhnhytqkslsl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3sgjC (C:)
    rtedlpkavvflepqwyrvlekdsvtlkcqgayspedqstqwfhneslissqassyfida
    atvddsgeyrcqtqlstlsdpvqlevhigwlllqaprwvfkeedpihlrchswkntalhk
    vtylqngkgrkyfhhnsdfyipkatlkdsgsyfcrglvgsknvssetvqititqglavst
    issffppgyqgkkkkkkghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sgjC (C:)
    pkavvflepqwyrvlekdsvtlkcqgayspedqstqwfhneslissqassyfidaatvdd
    sgeyrcqtqlstlsdpvqlevhigwlllqaprwvfkeedpihlrchswkntalhkvtylq
    ngkgrkyfhhnsdfyipkatlkdsgsyfcrglvgsknvssetvqititq