PDB entry 3sgh

View 3sgh on RCSB PDB site
Description: Crystal structure of a hypothetical susd-like protein (BT_3752) from Bacteroides thetaiotaomicron vpi-5482 at 1.70 A resolution
Class: sugar binding protein
Keywords: alpha-alpha superhelix, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, SUGAR BINDING PROTEIN
Deposited on 2011-06-14, released 2011-07-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-11-23, with a file datestamp of 2011-11-18.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.14
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SusD homolog
    Species: Bacteroides thetaiotaomicron [TaxId:818]
    Gene: BT_3752
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3sgha_
  • Chain 'B':
    Compound: SusD homolog
    Species: Bacteroides thetaiotaomicron [TaxId:818]
    Gene: BT_3752
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3sghb_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sghA (A:)
    gfedfntnpyqpskvpasnllstmfnvyacpqqnacqeincmwasfsgqvtatanwsfgk
    nifayynaseghndsswgrlygyiypsfflvenstekkgviyamaqltrvygmqllaslq
    gpipytqmkageteapydneqtvwhamfddldnaitilksaatfgvnqdlavvdqfykgd
    cskwlkfantlklrmairisgvepeyaqtkaqeavlggvmesvgdssydttngginengy
    aivsgwpevranaclvsymngyndprrpayftpqtqtaaggyvgvrsgsaeipeptvyan
    ysklfiatdktlpqpvmyaaeaaflraegalkgwnmggdaktfyekgvrlsfeefgvsga
    ddyladatsipgnyvdnliaghtgnnytnqssitikwedgaddakklervltqkwiacyp
    dpmngwadfrrtgyprifpatesmnadcntgrgqrrlrftrseynnnkanveaavsmlsn
    gkdsngtdlwwamkengty
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sghA (A:)
    pasnllstmfnvyacpqqnacqeincmwasfsgqvtatanwsfgknifayynaseghnds
    swgrlygyiypsfflvenstekkgviyamaqltrvygmqllaslqgpipytqmkagetea
    pydneqtvwhamfddldnaitilksaatfgvnqdlavvdqfykgdcskwlkfantlklrm
    airisgvepeyaqtkaqeavlggvmesvgdssydttngginengyaivsgwpevranacl
    vsymngyndprrpayftpqtqtaaggyvgvrsgsaeipeptvyanysklfiatdktlpqp
    vmyaaeaaflraegalkgwnmggdaktfyekgvrlsfeefgvsgaddyladatsipgnyv
    dnliaghtgnnytnqssitikwedgaddakklervltqkwiacypdpmngwadfrrtgyp
    rifpatesmnadcntgrgqrrlrftrseynnnkanveaavsmlsngkdsngtdlwwamke
    ngty
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3sghB (B:)
    gfedfntnpyqpskvpasnllstmfnvyacpqqnacqeincmwasfsgqvtatanwsfgk
    nifayynaseghndsswgrlygyiypsfflvenstekkgviyamaqltrvygmqllaslq
    gpipytqmkageteapydneqtvwhamfddldnaitilksaatfgvnqdlavvdqfykgd
    cskwlkfantlklrmairisgvepeyaqtkaqeavlggvmesvgdssydttngginengy
    aivsgwpevranaclvsymngyndprrpayftpqtqtaaggyvgvrsgsaeipeptvyan
    ysklfiatdktlpqpvmyaaeaaflraegalkgwnmggdaktfyekgvrlsfeefgvsga
    ddyladatsipgnyvdnliaghtgnnytnqssitikwedgaddakklervltqkwiacyp
    dpmngwadfrrtgyprifpatesmnadcntgrgqrrlrftrseynnnkanveaavsmlsn
    gkdsngtdlwwamkengty
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sghB (B:)
    pasnllstmfnvyacpqqnacqeincmwasfsgqvtatanwsfgknifayynaseghnds
    swgrlygyiypsfflvenstekkgviyamaqltrvygmqllaslqgpipytqmkagetea
    pydneqtvwhamfddldnaitilksaatfgvnqdlavvdqfykgdcskwlkfantlklrm
    airisgvepeyaqtkaqeavlggvmesvgdssydttngginengyaivsgwpevranacl
    vsymngyndprrpayftpqtqtaaggyvgvrsgsaeipeptvyanysklfiatdktlpqp
    vmyaaeaaflraegalkgwnmggdaktfyekgvrlsfeefgvsgaddyladatsipgnyv
    dnliaghtgnnytnqssitikwedgaddakklervltqkwiacypdpmngwadfrrtgyp
    rifpatesmnadcntgrgqrrlrftrseynnnkanveaavsmlsngkdsngtdlwwamke
    ngty