PDB entry 3sge

View 3sge on RCSB PDB site
Description: Crystal structure of mAb 17.2 in complex with R13 peptide
Class: immune system
Keywords: Immunoglobulin, Antigen binding, IMMUNE SYSTEM
Deposited on 2011-06-14, released 2011-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.181
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3SGE (0-216)
  • Chain 'I':
    Compound: light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3SGE (0-218)
    Domains in SCOPe 2.07: d3sgei1, d3sgei2
  • Chain 'J':
    Compound: heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3SGE (0-216)
  • Chain 'K':
    Compound: R13 peptide
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3SGE (0-End)
  • Chain 'L':
    Compound: light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3SGE (0-218)
    Domains in SCOPe 2.07: d3sgel1, d3sgel2
  • Chain 'M':
    Compound: R13 peptide
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3SGE (0-End)
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3sgeI (I:)
    dvvmtqtpltlsvtigqpasisckssqslldsdgktylnwllqrpgqspkrliylvskld
    sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgshfpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3sgeL (L:)
    dvvmtqtpltlsvtigqpasisckssqslldsdgktylnwllqrpgqspkrliylvskld
    sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgshfpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'M':
    No sequence available.