PDB entry 3sga

View 3sga on RCSB PDB site
Description: structures of product and inhibitor complexes of streptomyces griseus protease a at 1.8 angstroms resolution. a model for serine protease catalysis
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase-hydrolase inhibitor complex, serine proteinase
Deposited on 1990-05-29, released 1991-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-09-19, with a file datestamp of 2012-09-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.12
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'E':
  Compound: proteinase a (sgpa)
  Species: Streptomyces griseus [TaxId:1911]
  Gene: sprA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00776 (0-180)
    • conflict (131)
  Domains in SCOPe 2.08: d3sgae_
• Chain 'P':
  Compound: ace-pro-ala-pro-phe-aldehyde
  Database cross-references and differences (RAF-indexed):
  • PDB 3SGA (Start-3)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3sgaE (E:)
  iaggeaittggsrcslgfnvsvngvahaltaghctnisaswsigtrtgtsfpnndygiir
  hsnpaaadgrvylyngsyqdittagnafvgqavqrsgsttglrsgsvtglnatvnygssg
  ivygmiqtnvcaqpgdsggslfagstalgltsggsgncrtggttfyqpvtealsaygatv
  l
  

  
  
• Chain 'P':
  No sequence available.