PDB entry 3sfm

View 3sfm on RCSB PDB site
Description: Novel crystallization conditions for tandem variant R67 DHFR yields wild-type crystal structure
Class: oxidoreductase
Keywords: oxidoreductase, dihydrofolate reductase, antibiotic resistance, in situ proteolysis, type II DHFR, SH3, reductase, DHF and NADPH-binding
Deposited on 2011-06-13, released 2011-11-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.145
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydrofolate reductase type 2
    Species: Escherichia coli [TaxId:562]
    Gene: dfrB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00383 (4-61)
      • engineered mutation (4)
    Domains in SCOPe 2.05: d3sfma_
  • Heterogens: MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sfmA (A:)
    vfpsdatfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaaler
    in
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sfmA (A:)
    datfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaalerin