PDB entry 3sfm

View 3sfm on RCSB PDB site
Description: Novel crystallization conditions for tandem variant R67 DHFR yields wild-type crystal structure
Class: oxidoreductase
Keywords: oxidoreductase, dihydrofolate reductase, antibiotic resistance, in situ proteolysis, type II DHFR, SH3, reductase, DHF and NADPH-binding
Deposited on 2011-06-13, released 2011-11-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.145
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Dihydrofolate reductase type 2
  Species: Escherichia coli [TaxId:562]
  Gene: dfrB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00383 (4-61)
    • engineered mutation (4)
  Domains in SCOPe 2.08: d3sfma_
• Heterogens: MRD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3sfmA (A:)
  vfpsdatfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaaler
  in
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3sfmA (A:)
  datfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaalerin