PDB entry 3sfj

View 3sfj on RCSB PDB site
Description: Crystal Structure of Tax-Interacting Protein-1 (TIP-1) PDZ domain bound to iCAL36 inhibitor peptide
Class: signaling protein/inhibitor
Keywords: PDZ:peptide complex, SIGNALING PROTEIN-INHIBITOR complex
Deposited on 2011-06-13, released 2012-12-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-12-12, with a file datestamp of 2012-12-07.
Experiment type: XRAY
Resolution: 1.24 Å
R-factor: 0.181
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tax1-binding protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: TAX1BP3, TIP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3sfja_
  • Chain 'B':
    Compound: decameric peptide iCAL36
    Database cross-references and differences (RAF-indexed):
    • PDB 3SFJ (0-9)
  • Chain 'C':
    Compound: tax1-binding protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: TAX1BP3, TIP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14907 (1-103)
      • expression tag (0)
    Domains in SCOPe 2.08: d3sfjc1, d3sfjc2
  • Chain 'D':
    Compound: decameric peptide iCAL36
    Database cross-references and differences (RAF-indexed):
    • PDB 3SFJ (0-9)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3sfjA (A:)
vtavvqrveihklrqgenlilgfsigggidqdpsqnpfsedktdkgiyvtrvseggpaei
aglqigdkimqvngwdmtmvthdqarkrltkrseevvrllvtrq

    Sequence, based on observed residues (ATOM records): (download) 
    >3sfjA (A:)
tavvqrveihklrqgenlilgfsigggidqdpsqnpfsedktdkgiyvtrvseggpaeia
glqigdkimqvngwdmtmvthdqarkrltkrseevvrllvtrq

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3sfjC (C:)
vtavvqrveihklrqgenlilgfsigggidqdpsqnpfsedktdkgiyvtrvseggpaei
aglqigdkimqvngwdmtmvthdqarkrltkrseevvrllvtrq

  • Chain 'D':
    No sequence available.