PDB entry 3sfj
View 3sfj on RCSB PDB site
Description: Crystal Structure of Tax-Interacting Protein-1 (TIP-1) PDZ domain bound to iCAL36 inhibitor peptide
Class: signaling protein/inhibitor
Keywords: PDZ:peptide complex, SIGNALING PROTEIN-INHIBITOR complex
Deposited on
2011-06-13, released
2012-12-12
The last revision prior to the SCOPe 2.08 freeze date was dated
2012-12-12, with a file datestamp of
2012-12-07.
Experiment type: XRAY
Resolution: 1.24 Å
R-factor: 0.181
AEROSPACI score: 0.78
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: tax1-binding protein 3
Species: Homo sapiens [TaxId:9606]
Gene: TAX1BP3, TIP1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3sfja_ - Chain 'B':
Compound: decameric peptide iCAL36
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: tax1-binding protein 3
Species: Homo sapiens [TaxId:9606]
Gene: TAX1BP3, TIP1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3sfjc1, d3sfjc2 - Chain 'D':
Compound: decameric peptide iCAL36
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3sfjA (A:)
vtavvqrveihklrqgenlilgfsigggidqdpsqnpfsedktdkgiyvtrvseggpaei
aglqigdkimqvngwdmtmvthdqarkrltkrseevvrllvtrq
Sequence, based on observed residues (ATOM records): (download)
>3sfjA (A:)
tavvqrveihklrqgenlilgfsigggidqdpsqnpfsedktdkgiyvtrvseggpaeia
glqigdkimqvngwdmtmvthdqarkrltkrseevvrllvtrq
- Chain 'B':
No sequence available.
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>3sfjC (C:)
vtavvqrveihklrqgenlilgfsigggidqdpsqnpfsedktdkgiyvtrvseggpaei
aglqigdkimqvngwdmtmvthdqarkrltkrseevvrllvtrq
- Chain 'D':
No sequence available.