PDB entry 3sen

View 3sen on RCSB PDB site
Description: Structure of Caskin1 Tandem SAMs
Class: signaling protein
Keywords: SAM domain, Protein-Protein Interaction, SIGNALING PROTEIN
Deposited on 2011-06-10, released 2011-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.242
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Caskin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: CASKIN1, KIAA1306
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sena1, d3sena2
  • Chain 'B':
    Compound: Caskin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: CASKIN1, KIAA1306
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3senb1, d3senb2
  • Chain 'C':
    Compound: Caskin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: CASKIN1, KIAA1306
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3senc1, d3senc2
  • Chain 'D':
    Compound: Caskin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: CASKIN1, KIAA1306
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3send1, d3send2
  • Heterogens: K

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3senA (A:)
    mkhhhhhhhmhakegksseavsqwltafqlqlyapnfisagydlptisrmtpedltaigv
    tkpghrkkiaaeisglsipdwlpehkpanlavwlsmiglaqyykvlvdngyenidfitdi
    twedlqeigitklghqkklmlavrklaelqkaeyaky
    

    Sequence, based on observed residues (ATOM records): (download)
    >3senA (A:)
    ksseavsqwltafqlqlyapnfisagydlptisrmtpedltaigvtkpghrkkiaaeisg
    lsipdwlpehkpanlavwlsmiglaqyykvlvdngyenidfitditwedlqeigitklgh
    qkklmlavrklaelqkaeyaky
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3senB (B:)
    mkhhhhhhhmhakegksseavsqwltafqlqlyapnfisagydlptisrmtpedltaigv
    tkpghrkkiaaeisglsipdwlpehkpanlavwlsmiglaqyykvlvdngyenidfitdi
    twedlqeigitklghqkklmlavrklaelqkaeyaky
    

    Sequence, based on observed residues (ATOM records): (download)
    >3senB (B:)
    ksseavsqwltafqlqlyapnfisagydlptisrmtpedltaigvtkpghrkkiaaeisg
    lsipdwlpehkpanlavwlsmiglaqyykvlvdngyenidfitditwedlqeigitklgh
    qkklmlavrklaelqkaey
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3senC (C:)
    mkhhhhhhhmhakegksseavsqwltafqlqlyapnfisagydlptisrmtpedltaigv
    tkpghrkkiaaeisglsipdwlpehkpanlavwlsmiglaqyykvlvdngyenidfitdi
    twedlqeigitklghqkklmlavrklaelqkaeyaky
    

    Sequence, based on observed residues (ATOM records): (download)
    >3senC (C:)
    ksseavsqwltafqlqlyapnfisagydlptisrmtpedltaigvtkpghrkkiaaeisg
    lsipdwlpehkpanlavwlsmiglaqyykvlvdngyenidfitditwedlqeigitklgh
    qkklmlavrklaelqk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3senD (D:)
    mkhhhhhhhmhakegksseavsqwltafqlqlyapnfisagydlptisrmtpedltaigv
    tkpghrkkiaaeisglsipdwlpehkpanlavwlsmiglaqyykvlvdngyenidfitdi
    twedlqeigitklghqkklmlavrklaelqkaeyaky
    

    Sequence, based on observed residues (ATOM records): (download)
    >3senD (D:)
    ksseavsqwltafqlqlyapnfisagydlptisrmtpedltaigvtkpghrkkiaaeisg
    lsipdwlpehkpanlavwlsmiglaqyykvlvdngyenidfitditwedlqeigitklgh
    qkklmlavrklaelqka