PDB entry 3sec

View 3sec on RCSB PDB site
Description: Crystal structure of Methanothermobacter thermautotrophicus orotidine 5'-monophosphate decarboxylase complexed with pyrazofurin monophosphate
Class: lyase/lyase inhibitor
Keywords: orotidine 5'-monophosphate decarboxylase, Methanothermobacter thermautotrophicus, pyrazofurin monophosphate, decarboxylase, LYASE-LYASE INHIBITOR complex
Deposited on 2011-06-10, released 2012-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.157
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:187420]
    Gene: 1470090, MTH_129, pyrF
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • conflict (100)
    Domains in SCOPe 2.07: d3seca_
  • Heterogens: GOL, PFU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3secA (A:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllipedpaankarkea
    elaaata
    

    Sequence, based on observed residues (ATOM records): (download)
    >3secA (A:)
    vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
    fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
    aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpg
    etlrfadaiivgrsiyladnpaaaaagiiesikd