PDB entry 3sea

View 3sea on RCSB PDB site
Description: Structure of Rheb-Y35A mutant in GDP- and GMPPNP-bound forms
Class: Hydrolase
Keywords: globular, Hydrolase
Deposited on 2011-06-10, released 2012-06-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-09-26, with a file datestamp of 2012-09-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.167
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding protein Rheb
    Species: Homo sapiens [TaxId:9606]
    Gene: RHEB, RHEB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15382 (0-166)
      • engineered mutation (32)
    Domains in SCOPe 2.05: d3seaa_
  • Chain 'B':
    Compound: GTP-binding protein Rheb
    Species: Homo sapiens [TaxId:9606]
    Gene: RHEB, RHEB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15382 (0-166)
      • engineered mutation (32)
    Domains in SCOPe 2.05: d3seab_
  • Heterogens: MG, GDP, GNP, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3seaA (A:)
qsksrkiailgyrsvgkssltiqfvegqfvdsadptientftklitvngqeyhlqlvdta
gqdeysifpqtysidingyilvysvtsiksfevikvihgklldmvgkvqipimlvgnkkd
lhmervisyeegkalaeswnaaflessakenqtavdvfrriileaek

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3seaB (B:)
qsksrkiailgyrsvgkssltiqfvegqfvdsadptientftklitvngqeyhlqlvdta
gqdeysifpqtysidingyilvysvtsiksfevikvihgklldmvgkvqipimlvgnkkd
lhmervisyeegkalaeswnaaflessakenqtavdvfrriileaek