PDB entry 3se1

View 3se1 on RCSB PDB site
Description: Frog M-ferritin with magnesium, R72D mutant
Class: oxidoreductase
Keywords: iron storage, diiron, metal-binding, oxidoreductase
Deposited on 2011-06-10, released 2012-02-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07798
      • engineered mutation (72)
    Domains in SCOPe 2.07: d3se1a_
  • Heterogens: MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3se1A (A:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
    ehaekfmkyqnkdggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3se1A (A:)
    hsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheerehaekfmky
    qnkdggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdkvdphlcdf
    leseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkes