PDB entry 3sdy

View 3sdy on RCSB PDB site
Description: Crystal Structure of Broadly Neutralizing Antibody CR8020 Bound to the Influenza A H3 Hemagglutinin
Class: Viral Protein/Immune System
Keywords: Viral fusion protein, immunoglobulin, Virus attachment and entry, immune recognition, Viral Protein-Immune System complex
Deposited on 2011-06-09, released 2011-07-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-01-11, with a file datestamp of 2012-01-06.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.203
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91MA7 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.06: d3sdya1, d3sdya2
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91MA7 (0-End)
      • see remark 999 (122)
    Domains in SCOPe 2.06: d3sdyb_
  • Chain 'H':
    Compound: Antibody CR8020, Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: Immunoglobulin heavy chain locus (IGH)
    Database cross-references and differences (RAF-indexed):
    • PDB 3SDY (0-223)
  • Chain 'L':
    Compound: Antibody CR8020, Light Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: Immunoglobulin kappa chain locus (IGK)
    Database cross-references and differences (RAF-indexed):
    • PDB 3SDY (Start-215)
    Domains in SCOPe 2.06: d3sdyl1, d3sdyl2
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sdyA (A:)
    adpgatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctl
    idallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegft
    wtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhps
    tnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvin
    sngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacp
    kyvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sdyA (A:)
    pgatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
    allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
    gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstn
    qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
    gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
    vkqntlklatgmrnvpekq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3sdyB (B:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sdyB (B:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfq
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3sdyL (L:)
    qeivmtqspgtlslspgeratlscrasqsvsmnylawfqqkpgqaprlliygasrratgi
    pdrisgsgsgtdftltisrlepadfavyycqqygtsprtfgqgakveikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sdyL (L:)
    eivmtqspgtlslspgeratlscrasqsvsmnylawfqqkpgqaprlliygasrratgip
    drisgsgsgtdftltisrlepadfavyycqqygtsprtfgqgakveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec