PDB entry 3sdl

View 3sdl on RCSB PDB site
Description: Crystal structure of human ISG15 in complex with NS1 N-terminal region from influenza B virus, Northeast Structural Genomics Consortium Target IDs HX6481, HR2873, and OR2
Class: Viral Protein/antiviral Protein
Keywords: Structural Genomics, PSI-Biology, Northeast Structural Genomics Consortium, NESG, protein complex, viral protein/antiviral protein, Viral Protein-antiviral Protein complex
Deposited on 2011-06-09, released 2011-07-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-08-31, with a file datestamp of 2011-08-26.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: 0.224
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Non-structural protein 1
    Species: Influenza B virus [TaxId:107412]
    Gene: NS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3sdla_
  • Chain 'B':
    Compound: Non-structural protein 1
    Species: Influenza B virus [TaxId:107412]
    Gene: NS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3sdlb_
  • Chain 'C':
    Compound: Ubiquitin-like protein ISG15
    Species: Homo sapiens [TaxId:9606]
    Gene: G1P2, ISG15, UCRP
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Ubiquitin-like protein ISG15
    Species: Homo sapiens [TaxId:9606]
    Gene: G1P2, ISG15, UCRP
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3sdlA (A:)
mghhhhhhshmadnmtttqievgpgatnatinfeagilecyerfswqraldypgqdrlhr
lkrklesrikthnksepenkrmsleerkaigvkmmkvllfmdpsagiegfepy

    Sequence, based on observed residues (ATOM records): (download) 
    >3sdlA (A:)
ttqievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnkse
penkrmsleerkaigvkmmkvllfmdpsagiegfe

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3sdlB (B:)
mghhhhhhshmadnmtttqievgpgatnatinfeagilecyerfswqraldypgqdrlhr
lkrklesrikthnksepenkrmsleerkaigvkmmkvllfmdpsagiegfepy

    Sequence, based on observed residues (ATOM records): (download) 
    >3sdlB (B:)
ttqievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnkse
penkrmsleerkaigvkmmkvllfmdpsagiegfepy

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.