PDB entry 3sdl
View 3sdl on RCSB PDB site
Description: Crystal structure of human ISG15 in complex with NS1 N-terminal region from influenza B virus, Northeast Structural Genomics Consortium Target IDs HX6481, HR2873, and OR2
Class: Viral Protein/antiviral Protein
Keywords: Structural Genomics, PSI-Biology, Northeast Structural Genomics Consortium, NESG, protein complex, viral protein/antiviral protein, Viral Protein-antiviral Protein complex
Deposited on
2011-06-09, released
2011-07-20
The last revision prior to the SCOPe 2.03 freeze date was dated
2011-08-31, with a file datestamp of
2011-08-26.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: 0.224
AEROSPACI score: 0.36
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Non-structural protein 1
Species: Influenza B virus [TaxId:107412]
Gene: NS
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d3sdla_ - Chain 'B':
Compound: Non-structural protein 1
Species: Influenza B virus [TaxId:107412]
Gene: NS
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d3sdlb_ - Chain 'C':
Compound: Ubiquitin-like protein ISG15
Species: Homo sapiens [TaxId:9606]
Gene: G1P2, ISG15, UCRP
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: Ubiquitin-like protein ISG15
Species: Homo sapiens [TaxId:9606]
Gene: G1P2, ISG15, UCRP
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3sdlA (A:)
mghhhhhhshmadnmtttqievgpgatnatinfeagilecyerfswqraldypgqdrlhr
lkrklesrikthnksepenkrmsleerkaigvkmmkvllfmdpsagiegfepy
Sequence, based on observed residues (ATOM records): (download)
>3sdlA (A:)
ttqievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnkse
penkrmsleerkaigvkmmkvllfmdpsagiegfe
- Chain 'B':
Sequence, based on SEQRES records: (download)
>3sdlB (B:)
mghhhhhhshmadnmtttqievgpgatnatinfeagilecyerfswqraldypgqdrlhr
lkrklesrikthnksepenkrmsleerkaigvkmmkvllfmdpsagiegfepy
Sequence, based on observed residues (ATOM records): (download)
>3sdlB (B:)
ttqievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnkse
penkrmsleerkaigvkmmkvllfmdpsagiegfepy
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.