PDB entry 3sdg

View 3sdg on RCSB PDB site
Description: Ethionamide Boosters Part 2: Combining Bioisosteric Replacement and Structure-Based Drug Design to Solve Pharmacokinetic Issues in a Series of Potent 1,2,4-Oxadiazole EthR Inhibitors.
Class: transcription repressor/inhibitor
Keywords: tetr-family,inhibitor, DNA, transcription repressor-inhibitor complex, DNA binding protein, transcritptional regulatory repressor, DNA binding
Deposited on 2011-06-09, released 2011-12-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-01-25, with a file datestamp of 2012-01-20.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.205
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HTH-type transcriptional regulator EthR
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: etaR, ethR, MT3970, Rv3855
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3sdga1, d3sdga2
  • Heterogens: 3SE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sdgA (A:)
    mgsshhhhhhssglvprgshmttsaasqaslprgrrtarpsgddrelailataenlledr
    pladisvddlakgagisrptfyfyfpskeavlltlldrvvnqadmalqtlaenpadtdre
    nmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavidaerdrg
    aaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiygenr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sdgA (A:)
    elailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvnqadm
    alqtlaedrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiayta
    avidaerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvts
    iyge