PDB entry 3sd7

View 3sd7 on RCSB PDB site
Description: 1.7 Angstrom Resolution Crystal Structure of Putative Phosphatase from Clostridium difficile
Class: hydrolase
Keywords: Structural Genomics, haloacid dehalogenase-like hydrolase, Hydrolase, Center for Structural Genomics of Infectious Diseases, CSGID
Deposited on 2011-06-08, released 2011-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative phosphatase
    Species: Clostridium difficile [TaxId:272563]
    Gene: CD3605
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sd7a_
  • Heterogens: NA, CL, PGE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sd7A (A:)
    mhhhhhhssgvdlgtenlyfqsnamkknyeivlfdldgtltdpkegitksiqyslnsfgi
    kedlenldqfigpplhdtfkeyykfedkkakeavekyreyfadkgifenkiyenmkeile
    mlykngkillvatskptvfaetilryfdidryfkyiagsnldgtrvnkneviqyvldlcn
    vkdkdkvimvgdrkydiigakkigidsigvlygygsfeeiseseptyivenvesikdill
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sd7A (A:)
    kknyeivlfdldgtltdpkegitksiqyslnsfgikedlenldqfigpplhdtfkeyykf
    edkkakeavekyreyfadkgifenkiyenmkeilemlykngkillvatskptvfaetilr
    yfdidryfkyiagsnldgtrvnkneviqyvldlcnvkdkdkvimvgdrkydiigakkigi
    dsigvlygygsfeeiseseptyivenvesikdill